Align Trehalose/maltose transport system permease protein MalF (characterized)
to candidate WP_052597074.1 VV02_RS15280 sugar ABC transporter permease
Query= SwissProt::O51924 (295 letters) >NCBI__GCF_001190945.1:WP_052597074.1 Length = 302 Score = 159 bits (401), Expect = 1e-43 Identities = 96/278 (34%), Positives = 156/278 (56%), Gaps = 8/278 (2%) Query: 12 REAKLGYLMILPLLTVVLVFIILPVMGTFWISLHRDVTFIPEKPFVGLRNYLRVLSAREF 71 REA G L +LP + + +F LP++G +SL D + FVG NY R+L F Sbjct: 18 REAITGILFVLPTVVIFGIFKFLPILGAGAMSL-TDYQLNGDYTFVGADNYSRILQDDAF 76 Query: 72 WYSTFVTVSFSFVSVSLETILGLSFALILNERLKGRGVLRAIVLIPWAVPTIISARTWEL 131 W S VT + + V L ++ L+ A++L++ + G+ R+++ +P+ +++ W Sbjct: 77 WQSLKVTGLYVVIFVPLIVVVSLAGAVLLHQMQRYTGLFRSLLFVPYLCSFVLAGIVWTW 136 Query: 132 MYNYSYGLFNWILSILGVSPVNWL-GTPISAFFAIVIADVWKTTPFMTLLLLAGLQAIPQ 190 ++ G N L LG V ++ G+ + ++ + VWK + L+ LAGL+A+P Sbjct: 137 IFATD-GPLNAALGGLGFGSVPFISGSQLLVLGSLAMVSVWKGFGYSMLIFLAGLKALPA 195 Query: 191 DLYEAALIDGASMFERFKSITLPLLKPVLIVALILRTIDALRVFDIIYVLTGGGPGGATT 250 +++EAA IDGA + F ITLPLL+P+ + LI+ TI +VFD IYV+TGGGP A Sbjct: 196 EVHEAARIDGAGAWRTFWHITLPLLRPITLFVLIIETIVGFQVFDTIYVMTGGGPNRA-- 253 Query: 251 SISLLAFNY---YNLGDYGIGSAISILTFVLVLSFTIV 285 S SL+ F Y + D+G +A ++ FV+VL ++V Sbjct: 254 SHSLIYFLYDEGFKFFDFGYAAAAGVVLFVIVLLLSLV 291 Lambda K H 0.329 0.145 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 258 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 302 Length adjustment: 27 Effective length of query: 268 Effective length of database: 275 Effective search space: 73700 Effective search space used: 73700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory