GapMind for catabolism of small carbon sources

 

Protein WP_007700669.1 in Cronobacter universalis NCTC 9529

Annotation: NCBI__GCF_001277175.1:WP_007700669.1

Length: 501 amino acids

Source: GCF_001277175.1 in NCBI

Candidate for 22 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
myo-inositol catabolism iolT hi Major myo-inositol transporter IolT (characterized) 52% 96% 451.4 Probable metabolite transport protein CsbC 38% 345.1
D-cellobiose catabolism MFS-glucose med Myo-Inositol uptake porter, IolT1 (Km=0.2mM) (characterized) 45% 93% 392.5 Major myo-inositol transporter IolT 52% 451.4
D-glucose catabolism MFS-glucose med Myo-Inositol uptake porter, IolT1 (Km=0.2mM) (characterized) 45% 93% 392.5 Major myo-inositol transporter IolT 52% 451.4
lactose catabolism MFS-glucose med Myo-Inositol uptake porter, IolT1 (Km=0.2mM) (characterized) 45% 93% 392.5 Major myo-inositol transporter IolT 52% 451.4
D-maltose catabolism MFS-glucose med Myo-Inositol uptake porter, IolT1 (Km=0.2mM) (characterized) 45% 93% 392.5 Major myo-inositol transporter IolT 52% 451.4
sucrose catabolism MFS-glucose med Myo-Inositol uptake porter, IolT1 (Km=0.2mM) (characterized) 45% 93% 392.5 Major myo-inositol transporter IolT 52% 451.4
trehalose catabolism MFS-glucose med Myo-Inositol uptake porter, IolT1 (Km=0.2mM) (characterized) 45% 93% 392.5 Major myo-inositol transporter IolT 52% 451.4
D-xylose catabolism xylT lo D-xylose transporter; D-xylose-proton symporter (characterized) 38% 95% 308.9 Major myo-inositol transporter IolT 52% 451.4
L-arabinose catabolism araE lo Arabinose-proton symporter; Arabinose transporter (characterized) 36% 96% 289.3 Major myo-inositol transporter IolT 52% 451.4
D-galactose catabolism galP lo Arabinose-proton symporter; Arabinose transporter (characterized) 36% 96% 289.3 Major myo-inositol transporter IolT 52% 451.4
D-fructose catabolism glcP lo Glucose/fructose:H+ symporter, GlcP (characterized) 35% 100% 270 Major myo-inositol transporter IolT 52% 451.4
sucrose catabolism glcP lo Glucose/fructose:H+ symporter, GlcP (characterized) 35% 100% 270 Major myo-inositol transporter IolT 52% 451.4
glycerol catabolism PLT5 lo polyol transporter 5 (characterized) 32% 91% 244.6 Major myo-inositol transporter IolT 52% 451.4
D-mannitol catabolism PLT5 lo polyol transporter 5 (characterized) 32% 91% 244.6 Major myo-inositol transporter IolT 52% 451.4
D-ribose catabolism PLT5 lo polyol transporter 5 (characterized) 32% 91% 244.6 Major myo-inositol transporter IolT 52% 451.4
D-sorbitol (glucitol) catabolism SOT lo polyol transporter 5 (characterized) 32% 91% 244.6 Major myo-inositol transporter IolT 52% 451.4
xylitol catabolism PLT5 lo polyol transporter 5 (characterized) 32% 91% 244.6 Major myo-inositol transporter IolT 52% 451.4
myo-inositol catabolism HMIT lo Proton myo-inositol cotransporter; H(+)-myo-inositol cotransporter; Hmit; H(+)-myo-inositol symporter; Solute carrier family 2 member 13 (characterized) 37% 53% 234.6 Major myo-inositol transporter IolT 52% 451.4
D-fructose catabolism Slc2a5 lo The fructose/xylose:H+ symporter, PMT1 (polyol monosaccharide transporter-1). Also transports other substrates at lower rates. PMT2 is largely of the same sequence and function. Both are present in pollen and young xylem cells (Klepek et al., 2005). A similar ortholog has been identifed in pollen grains of Petunia hybrida (characterized) 31% 94% 222.2 Major myo-inositol transporter IolT 52% 451.4
sucrose catabolism Slc2a5 lo The fructose/xylose:H+ symporter, PMT1 (polyol monosaccharide transporter-1). Also transports other substrates at lower rates. PMT2 is largely of the same sequence and function. Both are present in pollen and young xylem cells (Klepek et al., 2005). A similar ortholog has been identifed in pollen grains of Petunia hybrida (characterized) 31% 94% 222.2 Major myo-inositol transporter IolT 52% 451.4
D-fructose catabolism frt1 lo Fructose:H+ symporter, Frt1 (characterized) 31% 79% 197.6 Major myo-inositol transporter IolT 52% 451.4
sucrose catabolism frt1 lo Fructose:H+ symporter, Frt1 (characterized) 31% 79% 197.6 Major myo-inositol transporter IolT 52% 451.4

Sequence Analysis Tools

View WP_007700669.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MTKEQYLTLNRASGPNSDAPTAPFVKVIAIIATLGGLLFGYDTGVISGALLFMGSELHLT
PLTTGLVTSSLLFGAAFGALLAGHMANAAGRKKIIIYLAVIFAIGAIGTAMAPDVSWMIF
FRLVLGVAVGGAAATVPVYIAEIAPANKRGQLVTLQELMIVSGQLLAYISNASFHELWGG
ESTWRWMLAVATLPAVLLWFGMMFMPDTPRWYAMKGRLAEARRVLDRTRRPEDVEWELME
IEETLEAQRAQGKPRLRELLTPWLFKLFMIGIGIAVIQQMTGVNTIMYYAPTVLTAVGMS
DNAALVATVANGVVSVLMTFVGIWMLGKIGRRTMTMIGQFGCTACLVFIGAVSYLLPETV
NGQPDALRGYMVLAGMLMFLCFQQGALSPVTWLLLSEIFPTRLRGIFMGGAVFSMWIANF
LISLFFPILLAWVGLSGTFFIFAAFGIVGATFVIKCVPETRNRSLEQIEHYLHDWLDSSP
EGQRRARERKAYRAQMDKARS

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory