Align D-lactate transporter, ATP-binding component (characterized)
to candidate WP_007697312.1 AFK65_RS10265 urea ABC transporter ATP-binding protein UrtD
Query= reanno::Phaeo:GFF1248 (251 letters) >NCBI__GCF_001277175.1:WP_007697312.1 Length = 265 Score = 162 bits (410), Expect = 6e-45 Identities = 92/247 (37%), Positives = 145/247 (58%), Gaps = 7/247 (2%) Query: 3 ILEVKNVGKRFGGLQALSDVNLSVRENTVHAIIGPNGAGKSTLLNCLVGKLIPDTGSVMF 62 +L+++ + F G QAL+D+ LS + IIGPNGAGK+TL++ + GK P +G ++ Sbjct: 24 VLQLEKINVSFDGFQALTDLTLSTGVGELRCIIGPNGAGKTTLMDVITGKTRPQSGRAIY 83 Query: 63 DGKSVLGRA-PYEINQMGISRVFQTPEIFGDLSVLENMMIPCFAKRDGAFEMNAISAVSG 121 D ++ L R P EI + GI R FQ P +F L+V EN+ + K D + ++ Sbjct: 84 DQQTDLTRLEPVEIARRGIGRKFQKPTVFEALTVFENLELA--QKGDKTVRGTLRARLNA 141 Query: 122 QRDILEKAEHMLEEMNMADKRHMNAASMSRGDKRRLEIGMCLSQEPRLLLLDEPTAGMAR 181 ++ ++ + ML + + +R A ++S G K+ LEIGM L QEP LLLLDEP AGM Sbjct: 142 EQT--DRIDAMLATLRLGAERQRQAGALSHGQKQFLEIGMLLMQEPHLLLLDEPAAGMTD 199 Query: 182 ADTNNTIDLLKQIKSERDITIAIIEHDMHVVFSLADRITVLAQGTPLVEDDPQNIKGNPK 241 A+T+ +L + + + ++ ++EHDM V ++AD++TVL QG L E ++ N + Sbjct: 200 AETDYAAELFRALAGKH--SLMVVEHDMGFVETIADKVTVLHQGQVLAEGSLAEVQANEQ 257 Query: 242 VREAYLG 248 V E YLG Sbjct: 258 VIEVYLG 264 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 265 Length adjustment: 24 Effective length of query: 227 Effective length of database: 241 Effective search space: 54707 Effective search space used: 54707 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory