Align D/L-lactic acid transporter; Lactate racemization operon protein LarD; Lactic acid channel (characterized)
to candidate WP_007704192.1 AFK65_RS00630 aquaporin
Query= SwissProt::F9UST3 (238 letters) >NCBI__GCF_001277175.1:WP_007704192.1 Length = 282 Score = 102 bits (253), Expect = 1e-26 Identities = 77/245 (31%), Positives = 124/245 (50%), Gaps = 24/245 (9%) Query: 4 QLIAEFMGTALMIIFGVGVHCSSVLKGTKYRGSGHIFAITTWGFGISVALFIFGNVC--- 60 + IAEF+GT L+I FGVG + + G + G I I WG G+++A+++ V Sbjct: 10 ECIAEFLGTGLLIFFGVGCVAALKVAGASF-GQWEISII--WGLGVAMAIYLTAGVSGAH 66 Query: 61 INPAMVLAQCLLGNIAWSLFIPYSVAEVLGGVVGSVIVWIMYADHF-------KASTDEI 113 +NPA+ +A L +P+ +++ G + +V+ +Y + F + Sbjct: 67 LNPAVTIALWLFACFDGRKVVPFIISQFAGAFCAAALVYGLYYNLFLDYEQTHHMVRGSV 126 Query: 114 SPITIRNLFCTAPAVR-NLPRNFFVELFDTFIFISGILAISE----IKTPGIVPIGVGLL 168 + + +F T P NL + F VE+ T I + ILA+++ I + P+ +GLL Sbjct: 127 ESLDLAGIFSTYPNPHINLVQAFAVEMIITAILMGVILALTDDGNGIPRGPLAPLLIGLL 186 Query: 169 VWAIGMGLGGPTGFAMNLARDMGPRIAHAILP----IANKADSDWQYGIIVPGIAPFVGA 224 + IG +G TGFAMN ARD+GP+ A A L +A D Y +VP + P VGA Sbjct: 187 IAVIGASMGPLTGFAMNPARDLGPK-AFAWLAGWGNVAFTGGRDIPY-FLVPALGPVVGA 244 Query: 225 AIAAW 229 A+ A+ Sbjct: 245 ALGAF 249 Lambda K H 0.330 0.145 0.470 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 252 Number of extensions: 21 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 238 Length of database: 282 Length adjustment: 24 Effective length of query: 214 Effective length of database: 258 Effective search space: 55212 Effective search space used: 55212 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory