Align ABC transporter for L-Arginine and L-Citrulline, permease component 2 (characterized)
to candidate WP_007707081.1 AFK65_RS06495 glutamine ABC transporter permease GlnP
Query= reanno::pseudo1_N1B4:Pf1N1B4_3433 (232 letters) >NCBI__GCF_001277175.1:WP_007707081.1 Length = 219 Score = 122 bits (306), Expect = 6e-33 Identities = 76/223 (34%), Positives = 121/223 (54%), Gaps = 9/223 (4%) Query: 1 MIFDYNVIWEALPLYLGGLVTTLKLLALSLFFGLLAALPLGLMRVSKQPVVNMSAWLFTY 60 M FD++VIW A+P+ L G TL + L L G++ L GL R + N A +F Sbjct: 1 MEFDWSVIWPAIPILLDGAKMTLWISILGLAGGIVIGLLAGLARSYGGWISNHIALVFIE 60 Query: 61 VIRGTPMLVQLFLIYYGLAQFEAVRESFLWPWLSSATFCAC-LAFAINTSAYTAEIIAGS 119 VIRGTP++VQ+ IY+ L +P + TF A + IN+ AY AEI GS Sbjct: 61 VIRGTPIVVQVMYIYFALPM--------AFPDIRIDTFTAAVITIMINSGAYIAEITRGS 112 Query: 120 LRATPNGEIEAAKAMGMSRIKMYKRILLPSALRRALPQYSNEVIMMLQTTSLASIVTLID 179 + + G EA A+G+SR + + +++P ALRR LP N++I+ ++ TSL ++ + Sbjct: 113 VLSIHKGFSEAGLALGLSRRETIRHVIMPLALRRMLPALGNQLIISIKDTSLFIVIGAAE 172 Query: 180 ITGAARTVNAQFYLPFEAYITAGVFYLCLTFILVRLFKMAEHR 222 +T + + + A + E + GV YL +T +L + ++ E R Sbjct: 173 LTRSGQEIIAGNFRALEIWTAVGVIYLIITQVLNIVLRILERR 215 Lambda K H 0.330 0.140 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 118 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 232 Length of database: 219 Length adjustment: 22 Effective length of query: 210 Effective length of database: 197 Effective search space: 41370 Effective search space used: 41370 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory