Align The fructose/xylose:H+ symporter, PMT1 (polyol monosaccharide transporter-1). Also transports other substrates at lower rates. PMT2 is largely of the same sequence and function. Both are present in pollen and young xylem cells (Klepek et al., 2005). A similar ortholog has been identifed in pollen grains of Petunia hybrida (characterized)
to candidate WP_007701521.1 AFK65_RS16050 sugar porter family MFS transporter
Query= TCDB::Q9XIH7 (511 letters) >NCBI__GCF_001277175.1:WP_007701521.1 Length = 464 Score = 235 bits (600), Expect = 2e-66 Identities = 147/469 (31%), Positives = 245/469 (52%), Gaps = 30/469 (6%) Query: 19 RGNRSRYAFACAILASMTSIILGYDIGVMSGASIFIKDDLKLSDVQLEILMGILNIYSLV 78 R +++ F C LA++ ++ G DIGV++GA FI D ++ Q E ++ + + V Sbjct: 9 RSHKAMTFFVC-FLAALAGLLFGLDIGVIAGALPFIAKDFNITPHQQEWVVSSMMFGAAV 67 Query: 79 GSGAAGRTSDWLGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAMMIAP 138 G+ +G S LGR+Y++++ F G+L FA N +++ R + G+ VG A AP Sbjct: 68 GAVGSGWLSSRLGRKYSLMIGSVLFVIGSLCSAFAPNAEVLIISRVLLGLAVGIASYTAP 127 Query: 139 VYTAEVAPASSRGFLTSFPEIFINIGILLGYVSNYFFSKLPEHLGWRFMLGVGAVPSVFL 198 +Y +E+AP RG + S ++ I IGIL Y+S+ FS WR+MLGV +P++ L Sbjct: 128 LYLSEIAPEKIRGSMISMYQLMITIGILGAYLSDTAFSYSG---AWRWMLGVITIPAILL 184 Query: 199 AIGVLAMPESPRWLVLQGRLGDAFKVLDKTSNTKEEAISRLDDIKRAVGIPDDMTDDVIV 258 IGV +P+SPRW + R DA +VL + ++ EA L++I+ ++ + Sbjct: 185 LIGVFFLPDSPRWFAAKRRFHDAERVLLRLRDSSAEAKRELEEIRESLKV---------- 234 Query: 259 VPNKKSAGKGVWKDLLVRPTPSVRHILIACLGIHFAQQASGIDAVVLYSPTIFSKAGLKS 318 K G ++KD + R + + + QQ +G++ ++ Y+P IF AG + Sbjct: 235 ----KQGGWALFKD-----NSNFRRAVFLGILLQVMQQFTGMNVIMYYAPKIFELAGYSN 285 Query: 319 KNDQLLATVAVGVVKTLFIVVGTCVVDRFGRRALLLTSMGGMFLSLTALGTSLTV-INRN 377 +Q+ TV VG+ L + +VDR+GR+ L+ M + LGT L + I+ Sbjct: 286 TTEQMWGTVIVGLTNVLATFIAIGLVDRWGRKPTLILGFIVMAAGMGILGTMLHMGIDSP 345 Query: 378 PGQTLKWAIGLAVTTVMTFVATFSIGAGPVTWVYCSEIFPVRLRAQGASLGVMLNRLMSG 437 GQ AV ++ F+ F++ AGP+ WV CSEI P++ R G +L N + + Sbjct: 346 AGQY------FAVAMLLMFIIGFAMSAGPLIWVLCSEIQPLKGRDFGITLSTTTNWIANM 399 Query: 438 IIGMTFLSLSKGLTIGGAFLLFAGVAAAAWVFFFTFLPETRGIPLEEME 486 I+G TFL++ L F ++AG+ V +PET+ + LE +E Sbjct: 400 IVGATFLTMLNTLGNAPTFWVYAGLNLFFIVLTVWLVPETKHVSLEHIE 448 Lambda K H 0.324 0.140 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 681 Number of extensions: 31 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 511 Length of database: 464 Length adjustment: 34 Effective length of query: 477 Effective length of database: 430 Effective search space: 205110 Effective search space used: 205110 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory