Align ABC transporter for L-Fucose, ATPase component (characterized)
to candidate WP_007705431.1 AFK65_RS02825 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::Smeli:SM_b21106 (365 letters) >NCBI__GCF_001277175.1:WP_007705431.1 Length = 369 Score = 321 bits (822), Expect = 2e-92 Identities = 176/364 (48%), Positives = 234/364 (64%), Gaps = 15/364 (4%) Query: 1 MAPVTLKKLVKRYGALEVVHGIDLEVKDREFIALVGPSGCGKSTTLRMIAGLEEVSGGAI 60 M+ + L+ + KR+G E +H I+L++ D EF VGPSGCGKST LRMIAGLEEVS G + Sbjct: 1 MSSIRLRNVTKRFGKTETLHNINLDIADGEFAVFVGPSGCGKSTLLRMIAGLEEVSDGEV 60 Query: 61 EIGGRKVNDLPPRARNISMVFQSYALYPHMTVAENMGFSLKIAGRPAEEIKTRVAEAAAI 120 IG +ND+ P R ++MVFQSYALYPHMTVAENMG+ LK+ P ++I+ +V A Sbjct: 61 LIGDEVMNDVAPAHRGVAMVFQSYALYPHMTVAENMGYGLKVNKVPKDQIRHQVEMVAKT 120 Query: 121 LDLAHLLERRPSQLSGGQRQRVAMGRAIVRQPDVFLFDEPLSNLDAKLRTQVRTEIKKLH 180 L L+HLL+R+P QLSGGQRQRVA+GRAIVR P VF+FDEPLSNLDA+LR ++R I +LH Sbjct: 121 LQLSHLLDRKPKQLSGGQRQRVAIGRAIVRNPQVFMFDEPLSNLDAELRVEMRLHIARLH 180 Query: 181 ARMQATMIYVTHDQVEAMTLSDRIVIMRDGHIEQVGTPEDVFRRPATKFVAGFIGSPPMN 240 ++ TM+YVTHDQ+EAMTL+D+IV+M G +EQ+G+P ++ P KFVAGFIGSP MN Sbjct: 181 QELKTTMVYVTHDQIEAMTLADKIVVMNYGKVEQMGSPMALYYNPVNKFVAGFIGSPKMN 240 Query: 241 MEEAVLT---DGKL--AFASGATLPLPPRFRSLVREGQKVTFGLRPDDVYPSGHGLHAGD 295 A + +G L + G TL L L ++G VT G+RP+ L G Sbjct: 241 FLPATVARWEEGALDVTLSQGKTLRLAIHTAPL-KQGDAVTLGIRPEH-------LSTGA 292 Query: 296 ADAVHEIELPVTITEPLGNETLVFTQFNGRDWVSRML-NPRPLRPGEAVPMSFDLARAHL 354 V + + E LGN T +F Q G D + +L P +AV + F+ + Sbjct: 293 QTGV-SLTFNCEVVERLGNNTYLFGQCYGHDNMKILLPGDVHFSPWQAVEVGFNPRDCMV 351 Query: 355 FDGE 358 FD + Sbjct: 352 FDAD 355 Lambda K H 0.320 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 387 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 369 Length adjustment: 30 Effective length of query: 335 Effective length of database: 339 Effective search space: 113565 Effective search space used: 113565 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory