Align UDP-glucose 4-epimerase (EC 5.1.3.2) (characterized)
to candidate WP_038857019.1 AFK65_RS11210 NAD-dependent epimerase
Query= BRENDA::P9WN67 (314 letters) >NCBI__GCF_001277175.1:WP_038857019.1 Length = 337 Score = 153 bits (386), Expect = 6e-42 Identities = 105/334 (31%), Positives = 165/334 (49%), Gaps = 29/334 (8%) Query: 1 MRALVTGAAGFIGSTLVDRLLADGHSVVGLDNF-----ATGRATNLEHLADNSAHVFVEA 55 M+ LVTGAAGFIG + +RLLA GH V+G+DN + L L ++A F + Sbjct: 1 MKFLVTGAAGFIGFHVSERLLAAGHQVIGIDNLNDYYDVNLKLARLNLLKQHTAFHFEKI 60 Query: 56 DIVTAD-LHAILEQHRPEVVFHLAAQIDVRRSVADPQFDAAVNVIGTVRLAEAARQTGVR 114 D+ + + QH+P+ V HLAAQ VR S+ +P A N+ G + + E R V Sbjct: 61 DLADRQAMETLFAQHQPQRVIHLAAQAGVRYSLENPHAYADANLTGHLNVLEGCRHHKVE 120 Query: 115 KIVHTSSGGSIYGTPPEYP-TPETAPTDPASPYAAGKVAGEIYLNTFRHLYGLDCSHIAP 173 +++ SS S+YG + P + + + P S YAA K A E+ +T+ HLYGL + + Sbjct: 121 HLLYASS-SSVYGLNRKMPFSTDDSVDHPVSLYAATKKANELMSHTYSHLYGLPTTGLRF 179 Query: 174 ANVYGPRQDPHGEAGVVAIFAQALLSGKPTRVFGDGTNTRDYVFVDDVVDAFVRV----- 228 VYGP P + F QA++ G V+ G RD+ ++DD+ +A VR+ Sbjct: 180 FTVYGPWGRPD---MALFKFTQAIVKGSSIDVYNHGQMRRDFTYIDDIAEAIVRLQDVIP 236 Query: 229 SADVGGGLR-------------FNIGTGKETSDRQLHSAVAAAVGGPDDPEFHPPRLGDL 275 AD + +NIG + SA+ A+G P + GD+ Sbjct: 237 QADPQWTVENGSPATSSAPYRVYNIGNSSPVALMDYISALEKALGKEAQKNMLPMQPGDV 296 Query: 276 KRSCLDIGLAERVLGWRPQIELADGVRRTVEYFR 309 + D +V+G++PQ + +GV+R VE+++ Sbjct: 297 LETSADTSALYKVIGFKPQTSVEEGVKRFVEWYK 330 Lambda K H 0.320 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 269 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 337 Length adjustment: 28 Effective length of query: 286 Effective length of database: 309 Effective search space: 88374 Effective search space used: 88374 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory