Align ABC transporter for D-Glucosamine, ATPase component (characterized)
to candidate WP_007705431.1 AFK65_RS02825 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::Smeli:SM_b21216 (360 letters) >NCBI__GCF_001277175.1:WP_007705431.1 Length = 369 Score = 304 bits (779), Expect = 2e-87 Identities = 163/310 (52%), Positives = 213/310 (68%), Gaps = 4/310 (1%) Query: 1 MSALEIRNIRKRYGEVETLKGIDIALESGEFLVLLGSSGCGKSTLLNIIAGLAEPSGGDI 60 MS++ +RN+ KR+G+ ETL I++ + GEF V +G SGCGKSTLL +IAGL E S G++ Sbjct: 1 MSSIRLRNVTKRFGKTETLHNINLDIADGEFAVFVGPSGCGKSTLLRMIAGLEEVSDGEV 60 Query: 61 LIGERSVLGVHPKDRDIAMVFQSYALYPNLSVARNIGFGLEMRRVPQAEHDKAVRDTARL 120 LIG+ + V P R +AMVFQSYALYP+++VA N+G+GL++ +VP+ + V A+ Sbjct: 61 LIGDEVMNDVAPAHRGVAMVFQSYALYPHMTVAENMGYGLKVNKVPKDQIRHQVEMVAKT 120 Query: 121 LQIENLLDRKPSQLSGGQRQRVAIGRALVRNPQVFLFDEPLSNLDAKLRMEMRTELKRLH 180 LQ+ +LLDRKP QLSGGQRQRVAIGRA+VRNPQVF+FDEPLSNLDA+LR+EMR + RLH Sbjct: 121 LQLSHLLDRKPKQLSGGQRQRVAIGRAIVRNPQVFMFDEPLSNLDAELRVEMRLHIARLH 180 Query: 181 QMLRTTVVYVTHDQIEAMTLATRIAVMRDGRIEQLAAPDEVYDRPATLYVAGFVGSPPMN 240 Q L+TT+VYVTHDQIEAMTLA +I VM G++EQ+ +P +Y P +VAGF+GSP MN Sbjct: 181 QELKTTMVYVTHDQIEAMTLADKIVVMNYGKVEQMGSPMALYYNPVNKFVAGFIGSPKMN 240 Query: 241 ILDAEMT---ANGLKIEGCEEVLPLPAAFNGAAWAGRRVKVGIRPEALRLAAGSEAQRLT 297 L A + L + + A G V +GIRPE L A + LT Sbjct: 241 FLPATVARWEEGALDVTLSQGKTLRLAIHTAPLKQGDAVTLGIRPEHLSTGAQTGVS-LT 299 Query: 298 ASVEVVELTG 307 + EVVE G Sbjct: 300 FNCEVVERLG 309 Lambda K H 0.320 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 374 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 369 Length adjustment: 29 Effective length of query: 331 Effective length of database: 340 Effective search space: 112540 Effective search space used: 112540 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory