Align N-acetyl-D-glucosamine kinase; EC 2.7.1.59 (characterized)
to candidate WP_038857443.1 AFK65_RS07850 N-acetylglucosamine kinase
Query= CharProtDB::CH_002679 (303 letters) >NCBI__GCF_001277175.1:WP_038857443.1 Length = 306 Score = 476 bits (1226), Expect = e-139 Identities = 220/302 (72%), Positives = 263/302 (87%) Query: 1 MYYGFDIGGTKIALGVFDSGRQLQWEKRVPTPRDSYDAFLDAVCELVAEADQRFGCKGSV 60 MYYGFDIGG+KIALGV+D R+LQW+ RV TP DSY+ FLDA+ L EAD+RFG G V Sbjct: 1 MYYGFDIGGSKIALGVYDDARRLQWQTRVATPHDSYENFLDALSALATEADRRFGGAGHV 60 Query: 61 GIGIPGMPETEDGTLYAANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT 120 G+GIPG+PET+DG LYAAN+PAASG+ +R DLS RL RDVR+DNDANCFALSEAWDDEF+ Sbjct: 61 GVGIPGIPETDDGLLYAANLPAASGRAVRRDLSERLGRDVRIDNDANCFALSEAWDDEFS 120 Query: 121 QYPLVMGLILGTGVGGGLIFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGCG 180 YP+VMGLILGTGVGGG+I +GKP+TG+S+ITGEFGH+RLPVDAL ++G D P RCGCG Sbjct: 121 AYPVVMGLILGTGVGGGVIVDGKPVTGRSFITGEFGHIRLPVDALAILGRDIPFIRCGCG 180 Query: 181 QHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGNI 240 QHGCIENYLSGRGFAWL+QH+YH+ L+APEIIA + QGD +A+AHVERY DLLA C+ ++ Sbjct: 181 QHGCIENYLSGRGFAWLWQHFYHESLEAPEIIARWQQGDARAQAHVERYTDLLAACVASL 240 Query: 241 LTIVDPDLVVIGGGLSNFPAITTQLADRLPRHLLPVARVPRIERARHGDAGGMRGAAFLH 300 LT++DP LVV+GGGLS F +TT L+ +LP +LLPVA+VPRIE+ARHGDAGGMRGAAFLH Sbjct: 241 LTVLDPHLVVLGGGLSGFSHLTTALSAKLPAYLLPVAKVPRIEQARHGDAGGMRGAAFLH 300 Query: 301 LT 302 LT Sbjct: 301 LT 302 Lambda K H 0.323 0.143 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 414 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 306 Length adjustment: 27 Effective length of query: 276 Effective length of database: 279 Effective search space: 77004 Effective search space used: 77004 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory