Align NAD-dependent glycerol dehydrogenase; Dha-forming NAD-dependent glycerol dehydrogenase; EC 1.1.1.6 (characterized)
to candidate WP_007700802.1 AFK65_RS15785 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD
Query= SwissProt::Q92EU6 (254 letters) >NCBI__GCF_001277175.1:WP_007700802.1 Length = 253 Score = 149 bits (376), Expect = 5e-41 Identities = 86/245 (35%), Positives = 142/245 (57%), Gaps = 3/245 (1%) Query: 10 FNITDKVAVVTGAASGIGKAMAELFSEKGAYVVLLDIKEDVKDVAAQINPSRT-LALQVD 68 F++ KVA+VTG +G+G+ MA +E G +V ++I E + + R L+L D Sbjct: 6 FSLQGKVAIVTGCDTGLGQGMALGLAEAGCDIVGINIVEPTETIERVTALGRRFLSLTAD 65 Query: 69 ITKKENIEKVVAEIKKVYPKIDILANSAGVALLEKAEDLPEEYWDKTMELNLKGSFLMAQ 128 + K + I +++ + +D+L N+AG+ E A + E+ WD M LN+K F M+Q Sbjct: 66 LRKIDAIPELIERAVAEFGHVDVLVNNAGLIRREDAINFSEQDWDDVMNLNIKSVFFMSQ 125 Query: 129 IIGREMIATG-GGKIVNMASQASVIALDKHVAYCASKAAIVSMTQVLAMEWAPYNINVNA 187 + ++ IA G GGKI+N+AS S + +Y ASK+ ++ +T+++A EWA +NINVNA Sbjct: 126 TVAKQFIAQGNGGKIINIASMLSFQGGIRVPSYTASKSGVMGITRLMANEWAKHNINVNA 185 Query: 188 ISPTVILTELGKKAWAG-QVGEDMKKLIPAGRFGYPEEVAACALFLVSDAASLITGENLI 246 I+P + T ++ A Q ++ IPAGR+G P ++ +FL S A+ I G + Sbjct: 186 IAPGYMATNNTQQLRADEQRSAEILDRIPAGRWGLPSDLMGPVVFLASSASDYINGYTVA 245 Query: 247 IDGGY 251 +DGG+ Sbjct: 246 VDGGW 250 Lambda K H 0.316 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 253 Length adjustment: 24 Effective length of query: 230 Effective length of database: 229 Effective search space: 52670 Effective search space used: 52670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory