Align PTS lactose transporter subunit IIB, component of PTS-type lactose transporter, IIC-IIB-IIA (characterized)
to candidate WP_007704698.1 AFK65_RS01620 PTS sugar transporter subunit IIB
Query= TCDB::U5MIE1 (102 letters) >NCBI__GCF_001277175.1:WP_007704698.1 Length = 102 Score = 115 bits (288), Expect = 1e-31 Identities = 61/101 (60%), Positives = 74/101 (73%) Query: 1 MPRIVLYCAAGMSTSMLVNKMKAEAQQRALALEIYAVAVAEFERELPHADVILLGPQVKY 60 M IVL CAAGMSTSMLV +MK AQ++ + + I AV VAEF+ + AD++LLGPQVKY Sbjct: 1 MKNIVLCCAAGMSTSMLVQRMKDAAQKKGVEVAIKAVPVAEFKDIIGTADIVLLGPQVKY 60 Query: 61 EAGRLAALAAPQGKAVAVIDMADYGMMRGAAVLDKALALLE 101 E + +A P GK VAVIDM DYGMM+G VLDKAL +LE Sbjct: 61 EQPKFQEIADPLGKKVAVIDMMDYGMMKGDVVLDKALKMLE 101 Lambda K H 0.322 0.133 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 59 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 102 Length of database: 102 Length adjustment: 11 Effective length of query: 91 Effective length of database: 91 Effective search space: 8281 Effective search space used: 8281 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 40 (20.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory