Align Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized)
to candidate WP_007705431.1 AFK65_RS02825 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= SwissProt::P19566 (369 letters) >NCBI__GCF_001277175.1:WP_007705431.1 Length = 369 Score = 367 bits (941), Expect = e-106 Identities = 192/357 (53%), Positives = 247/357 (69%), Gaps = 1/357 (0%) Query: 1 MASVQLRNVTKAWGDVVVSKDINLDIHDGEFVVFVGPSGCGKSTLLRMIAGLETITSGDL 60 M+S++LRNVTK +G +INLDI DGEF VFVGPSGCGKSTLLRMIAGLE ++ G++ Sbjct: 1 MSSIRLRNVTKRFGKTETLHNINLDIADGEFAVFVGPSGCGKSTLLRMIAGLEEVSDGEV 60 Query: 61 FIGETRMNDIPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVMNQRVNQVAEV 120 IG+ MND+ PA RGV MVFQSYALYPH++VAENM +GLK+ K+ + +V VA+ Sbjct: 61 LIGDEVMNDVAPAHRGVAMVFQSYALYPHMTVAENMGYGLKVNKVPKDQIRHQVEMVAKT 120 Query: 121 LQLAHLLERKPKALSGGQRQRVAIGRTLVAEPRVFLLDEPLSNLDAALRVQMRIEISRLH 180 LQL+HLL+RKPK LSGGQRQRVAIGR +V P+VF+ DEPLSNLDA LRV+MR+ I+RLH Sbjct: 121 LQLSHLLDRKPKQLSGGQRQRVAIGRAIVRNPQVFMFDEPLSNLDAELRVEMRLHIARLH 180 Query: 181 KRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMN 240 + L TM+YVTHDQ+EAMTLADKIVV++ G+V Q+G P+ LY+ P ++FVAGFIGSPKMN Sbjct: 181 QELKTTMVYVTHDQIEAMTLADKIVVMNYGKVEQMGSPMALYYNPVNKFVAGFIGSPKMN 240 Query: 241 FLPVKVTATAIEQVQVELPNRQQIWLPVESRGVQVGANMSLGIRPEHLLPSDIADVTLEG 300 FLP V + V L + + L + + ++ G ++LGIRPEHL V+L Sbjct: 241 FLPATVARWEEGALDVTLSQGKTLRLAIHTAPLKQGDAVTLGIRPEHLSTGAQTGVSLTF 300 Query: 301 EVQVVEQLGHETQIHIQIPAIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDG 357 +VVE+LG+ T + Q + DV A +G P C +F DG Sbjct: 301 NCEVVERLGNNTYLFGQCYGHDNMKILLPGDVHFSPWQAV-EVGFNPRDCMVFDADG 356 Lambda K H 0.321 0.138 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 403 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 369 Length of database: 369 Length adjustment: 30 Effective length of query: 339 Effective length of database: 339 Effective search space: 114921 Effective search space used: 114921 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory