Align MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized)
to candidate WP_007700807.1 AFK65_RS15775 ABC transporter ATP-binding protein
Query= TCDB::Q9X103 (369 letters) >NCBI__GCF_001277175.1:WP_007700807.1 Length = 375 Score = 347 bits (890), Expect = e-100 Identities = 191/375 (50%), Positives = 249/375 (66%), Gaps = 15/375 (4%) Query: 3 MAQVVLENVTKVYENKVVAVKNANLVVEDKEFVVLLGPSGCGKTTTLRMIAGLEEITDGK 62 MA+V+ + KVY N AV +L + D EF+V++GPSGC K+TTLRM+AGLE I+ G+ Sbjct: 1 MAEVIFNKLEKVYSNGFKAVHGIDLKIADGEFMVIVGPSGCAKSTTLRMLAGLETISGGE 60 Query: 63 IYIDGKVVNDVEPKDRDIAMVFQNYALYPHMTVYENMAFGLKLRKYPKDEIDRRVREAAK 122 + I K+VN++ PK+R IAMVFQNYALYPHMTV EN+AFGLKL K PKD+I+R+V EAAK Sbjct: 61 VRIGEKLVNNLAPKERGIAMVFQNYALYPHMTVRENLAFGLKLSKLPKDQINRQVDEAAK 120 Query: 123 ILGIENLLDRKPRQLSGGQRQRVAVGRAIVRNPKVFLFDEPLSNLDAKLRVQMRSELKKL 182 IL +E LLDR PRQLSGGQ QRVAVGRAIV+ P VFLFDEPLSNLDAKLR MR + L Sbjct: 121 ILELEELLDRLPRQLSGGQAQRVAVGRAIVKKPDVFLFDEPLSNLDAKLRASMRIRISDL 180 Query: 183 HHRLQ-----ATIIYVTHDQVEAMTMADKIVVMKDGEIQQIGTPHEIYNSPANVFVAGFI 237 H +L+ AT +YVTHDQ EAMTM D+I VMK G I Q+ TP +Y+ P N+FVAGFI Sbjct: 181 HKQLKKSGKPATTVYVTHDQTEAMTMGDRICVMKLGHIMQVDTPDNLYHYPKNMFVAGFI 240 Query: 238 GSPPMNFVNARVVRGEGGLWIQASGFKVKVPKEFEDKLANYIDKEIIFGIRPEDIYDKLF 297 G+P MN ++V G L I ++ + ++K+A Y +++ FGIRPE I Sbjct: 241 GAPEMNIKPGKLVEEAGQLLICIGDNRLALTPRQQEKVAAYAGQQVFFGIRPEYI---SI 297 Query: 298 ALAPSPENTITGVVDVVEPLGSETILHVKVGDDLIVASVNPRTQAKE------EQKIDLV 351 + P E G + VE +G E +++KV D + + P +AK +K+ Sbjct: 298 SDTPYAEPCGAGELVRVENMGHEFFVYLKVADFEMTCRI-PSDEAKPMIDKGLHRKVYFK 356 Query: 352 LDMTRMHAFDKETEK 366 DM + H FD +TE+ Sbjct: 357 FDMNKCHLFDAKTEQ 371 Lambda K H 0.319 0.138 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 400 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 369 Length of database: 375 Length adjustment: 30 Effective length of query: 339 Effective length of database: 345 Effective search space: 116955 Effective search space used: 116955 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory