Align L-rhamnose 1-dehydrogenase (NADP(+)); RHAD; EC 1.1.1.377 (characterized)
to candidate WP_007700802.1 AFK65_RS15785 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD
Query= SwissProt::Q9HK58 (254 letters) >NCBI__GCF_001277175.1:WP_007700802.1 Length = 253 Score = 129 bits (324), Expect = 6e-35 Identities = 77/246 (31%), Positives = 132/246 (53%), Gaps = 3/246 (1%) Query: 5 KGKNAVITGGSRGIGRAIALGLAKQGANILISYASHDSEADEVLETASKYGVKAHKVKVD 64 +GK A++TG G+G+ +ALGLA+ G +I+ + E E +E + G + + D Sbjct: 9 QGKVAIVTGCDTGLGQGMALGLAEAGCDIV---GINIVEPTETIERVTALGRRFLSLTAD 65 Query: 65 QSDPYESIRFAEKAIETFGKVHILVDNAGICPFEDFFRISVDLFEKVWKVNVESHYFITQ 124 E+A+ FG V +LV+NAG+ ED S ++ V +N++S +F++Q Sbjct: 66 LRKIDAIPELIERAVAEFGHVDVLVNNAGLIRREDAINFSEQDWDDVMNLNIKSVFFMSQ 125 Query: 125 RIAKNMIENKINGRILLISSISAHVGGEFQTHYTTTKSALNGFMHSIAIVLGKYGILVNS 184 +AK I G+I+ I+S+ + GG YT +KS + G +A K+ I VN+ Sbjct: 126 TVAKQFIAQGNGGKIINIASMLSFQGGIRVPSYTASKSGVMGITRLMANEWAKHNINVNA 185 Query: 185 LEPGTILTDINKEDLSNQEKRAYMERRTVVGRLGLPEDMVAPALFLLSDDNTYVTGTELL 244 + PG + T+ ++ +++++ A + R GR GLP D++ P +FL S + Y+ G + Sbjct: 186 IAPGYMATNNTQQLRADEQRSAEILDRIPAGRWGLPSDLMGPVVFLASSASDYINGYTVA 245 Query: 245 ADGGML 250 DGG L Sbjct: 246 VDGGWL 251 Lambda K H 0.318 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 130 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 253 Length adjustment: 24 Effective length of query: 230 Effective length of database: 229 Effective search space: 52670 Effective search space used: 52670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory