Align PTS system, fructose-specific, IIB subunnit, component of Fructose Enzyme II complex (IIAFru - IIBFru - IICFru) (based on homology) (characterized)
to candidate WP_007699731.1 AFK65_RS13270 PTS fructose transporter subunit IIBC
Query= TCDB::D2RXA4 (150 letters) >NCBI__GCF_001277175.1:WP_007699731.1 Length = 565 Score = 82.4 bits (202), Expect = 1e-20 Identities = 46/132 (34%), Positives = 71/132 (53%), Gaps = 8/132 (6%) Query: 2 KFVAVTSCPTGIAHSQMAAENLEQTATDRGHEIDVEVQGAMGQENELSSDAIAEADAVII 61 + VAVT+CPTG+AH+ MAAE +E A RG + VE +G++G N ++ + +A+AD VI+ Sbjct: 107 RIVAVTACPTGVAHTFMAAEAIETEAKKRGWWVKVETRGSVGAGNAITPEEVAQADLVIV 166 Query: 62 AADTSVNQDRFEGKPVVTAPVKDAVNDVEDLLERAIAAADGETSTADSAQSEGAADASAS 121 AAD V+ +F GKP+ A+ ++A+A A A A+A+ Sbjct: 167 AADIEVDLAKFAGKPMYRTSTGLALKKTAQEFDKAVAEA--------KPYQPAGAGAAAT 218 Query: 122 DAEAADSGAPRR 133 D + P R Sbjct: 219 DKKEQGGAGPYR 230 Score = 24.3 bits (51), Expect = 0.003 Identities = 23/95 (24%), Positives = 40/95 (42%), Gaps = 12/95 (12%) Query: 40 GAMGQENELS-SDAIAEADAVIIAADTSVNQDRFEGKPVVTAPVKDAVNDVEDLLERAIA 98 GA Q+ +L +D +A+ I+ GK V + RA+A Sbjct: 24 GAAAQKAQLELTDNPNDAELAIVIGSAVPADASLNGKKVYLGDIN-----------RAVA 72 Query: 99 AADGETSTADSAQSEGAADASASDAEAADSGAPRR 133 + S A S + +A A+A+ A +A++ P+R Sbjct: 73 HPELFLSEAKSHAAAYSAPAAAAPAASANASGPKR 107 Lambda K H 0.307 0.122 0.323 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 130 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 150 Length of database: 565 Length adjustment: 26 Effective length of query: 124 Effective length of database: 539 Effective search space: 66836 Effective search space used: 66836 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory