Align ABC transporter for Xylitol, permease component 2 (characterized)
to candidate WP_007706701.1 AFK65_RS05690 carbohydrate ABC transporter permease
Query= reanno::Dino:3607127 (272 letters) >NCBI__GCF_001277175.1:WP_007706701.1 Length = 281 Score = 182 bits (461), Expect = 9e-51 Identities = 95/258 (36%), Positives = 151/258 (58%), Gaps = 10/258 (3%) Query: 21 CVFPFYWMVTTSLKTQ---IVALEAPPVWIFEPTLSNYREALFEDGVLRTLINSLIIAIS 77 CVFPFY+ + +SL+ P W ++ NY AL ++G+ R+L+NS+++A+ Sbjct: 27 CVFPFYYAIISSLRAGQELFTPAYFPNSWHWD----NYVVALVDNGIARSLLNSVLVAVV 82 Query: 78 TTFLALVLGVPAAFALARFEFRGKKDLWFWFITNRMISPIVLALPFFLIARNLGLLDKHI 137 T L L++ V AAFALAR FRG++ L F + M + + F + R LGL D Sbjct: 83 TVGLCLLVSVTAAFALARVPFRGRRVLLFTILCVSMFPQVAVLTGMFELVRFLGLYDSLG 142 Query: 138 TLILIYLTFNLPIVIWIVTDQFRGIPYDLDEAARLEGASQFTIMRKICLPLAMPGVAVSA 197 L++ Y TF+LP +W++T + IP +L+EAA ++GA TI+R++ P+ P + + Sbjct: 143 ALVISYTTFSLPFTVWVLTTFMKSIPVELEEAAIVDGAKTGTIIRRVFAPVLAPALVTTG 202 Query: 198 IFSFIFSWNELMFGLILTRSEAKTAPAMAVSFMEG---YNLPYGKIMATSTLIVIPVLIF 254 + +FI +WNE MF L S K +A+S G Y LP+G IMA S ++ +P+++ Sbjct: 203 LLAFIGAWNEFMFALTFIISGDKRTVPVAISMFSGASSYELPWGSIMAASVVVTLPIIVL 262 Query: 255 ALIASKQLVRGLTMGAVK 272 +I K++V GLT GA+K Sbjct: 263 VIIFQKRIVSGLTSGAIK 280 Lambda K H 0.331 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 250 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 281 Length adjustment: 25 Effective length of query: 247 Effective length of database: 256 Effective search space: 63232 Effective search space used: 63232 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory