Align The fructose inducible fructose/xylitol porter, FruI (characterized)
to candidate WP_007699731.1 AFK65_RS13270 PTS fructose transporter subunit IIBC
Query= TCDB::Q1LZ59 (655 letters) >NCBI__GCF_001277175.1:WP_007699731.1 Length = 565 Score = 337 bits (865), Expect = 7e-97 Identities = 213/561 (37%), Positives = 317/561 (56%), Gaps = 55/561 (9%) Query: 107 DGANDTHLAAL------AELSQYLLKDGFADKLRQVTNPDDVINLFNATEEEKKEATPAA 160 D ND LA + A+ S K D R V +P+ ++ + AA Sbjct: 36 DNPNDAELAIVIGSAVPADASLNGKKVYLGDINRAVAHPELFLSEAKSHAAAYSAPAAAA 95 Query: 161 PVADSHDF----LVAVTACTTGIAHTYMAEEALKKQAAEMGVGIKVETNGASGVGNKLTA 216 P A ++ +VAVTAC TG+AHT+MA EA++ +A + G +KVET G+ G GN +T Sbjct: 96 PAASANASGPKRIVAVTACPTGVAHTFMAAEAIETEAKKRGWWVKVETRGSVGAGNAITP 155 Query: 217 DDIKRAKGVIIAADKAVEMDRFNGKPLISRPVAEGIKKPEELINIILDGKAEAYVADNSD 276 +++ +A VI+AAD V++ +F GKP+ +KK + + + AEA + Sbjct: 156 EEVAQADLVIVAADIEVDLAKFAGKPMYRTSTGLALKKTAQEFDKAV---AEAKPYQPAG 212 Query: 277 LSSEASSSEKAGLGSAFYKHLMSGVSQMLPFVIGGGIMIALSFLIDQFMGVPKSSLSHLG 336 + A+ ++ G G+ Y+HL++GVS MLP V+ GG++IALSF+ + +L+ Sbjct: 213 AGAAATDKKEQG-GAGPYRHLLTGVSYMLPMVVAGGLLIALSFVFGIEAFKQEGTLA--- 268 Query: 337 NYHEIAAIFNQVGNAAFGFMIPVFAAYIAYSIAEKPGLVAGFVAGSMATTGLAFNKVAFF 396 AA+ G +AF M+PV A YIA+SIA++PGL G + G +A + Sbjct: 269 -----AALMKIGGGSAFALMVPVLAGYIAFSIADRPGLTPGLIGGMLAVS---------- 313 Query: 397 EFGEKASQASLTGIPSGFLGALAGGFLAGGVILVLKKALAFVPRSLEGIKSILLYPLLGV 456 TG SGF+G + GFLAG V + + +P+S+E +K IL+ PL Sbjct: 314 -----------TG--SGFIGGIIAGFLAGYVAKAISGKVK-LPQSMEALKPILIIPLFSS 359 Query: 457 LVTGFLMLFV-NIPMAAINTALYNFLGNLSGGSAVLLGLIVGGMMAIDMGGPFNKAAYVF 515 L+ G M++V P+A I L +L ++ +AVLLG I+G MM DMGGP NKAAY F Sbjct: 360 LIVGLAMIYVIGTPVAKILAGLTAWLQSMGTANAVLLGAILGAMMCTDMGGPVNKAAYAF 419 Query: 516 GTSTLTAAALAKGGSVVMASVMAGGMVPPLAVFVATLLFKNKFTQEEHDAGLTNIVMGLS 575 G L++ A MA++MA GMVPPLA+ +ATL+ + KF + + + G +V+GL Sbjct: 420 GVGLLSSQVYAP-----MAAIMAAGMVPPLAMGIATLVARRKFDKGQQEGGKAALVLGLC 474 Query: 576 FITEGAIPFGAGDPARAIPSFIVGSAVTGALVGLSGIKLMAPHGGIFVIALTS--NPLL- 632 FI+EGAIPF A DP R IP I G A+TGA+ G KLMAPHGG+FV+ + +P+L Sbjct: 475 FISEGAIPFAARDPMRVIPCCIAGGALTGAISMAIGAKLMAPHGGLFVLLIPGAISPVLG 534 Query: 633 YLLYIAVGAVIAGILFGSLRK 653 YLL I G+++AG+++ L++ Sbjct: 535 YLLAIVAGSLLAGLVYAFLKR 555 Lambda K H 0.320 0.137 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 924 Number of extensions: 60 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 655 Length of database: 565 Length adjustment: 37 Effective length of query: 618 Effective length of database: 528 Effective search space: 326304 Effective search space used: 326304 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory