Align D-xylose 1-dehydrogenase (EC 1.1.1.175) (characterized)
to candidate WP_007700187.1 AFK65_RS14005 (S)-acetoin forming diacetyl reductase
Query= reanno::Korea:Ga0059261_1894 (259 letters) >NCBI__GCF_001277175.1:WP_007700187.1 Length = 256 Score = 128 bits (322), Expect = 1e-34 Identities = 87/250 (34%), Positives = 124/250 (49%), Gaps = 11/250 (4%) Query: 19 KRVLVTGGGSGIGAGIVEGFARQGADVTFFDIAGAESQLLVERLSADGHKACFERVDLTD 78 K LVTG G GIG I + G V D + + + ++ G A VD++ Sbjct: 3 KVALVTGAGQGIGKAIALRLVKDGFAVAIADYNAETANAVAQEINEQGGSAVAVTVDVSK 62 Query: 79 VASLQAVIARLIKGAGGFDILVNNAANDDRHAIDEITEAYWDERLSVNLKHIFFCAQAVV 138 + A + + K GGFD++VNNA I+ ITE D ++N+K + + QA + Sbjct: 63 RDQVFAAVEQTRKALGGFDVIVNNAGIAPSTPIETITEEVIDRVYNINVKGVIWGMQAAI 122 Query: 139 PAMRARG-GGAIVNLGSISWHLGLSDLVLYQTCKAAIEGLTRSLARDLGRDGIRATCVIP 197 A +A G GG I+N S + H+G +L +Y + K A+ GLT++ ARDL GI P Sbjct: 123 EAFKAEGHGGKIINACSQAGHVGNPELAVYSSSKFAVRGLTQTAARDLAPLGITVNGFCP 182 Query: 198 GNVRTPRQLKWYSPEGEA---------EIVAAQCLDGRLA-PEDVAAMVLFLASDDARLV 247 G V+TP + EA E A + GRL+ PEDVAA V FLA D+ + Sbjct: 183 GIVKTPMWAEIDRQISEAAGKPLGYGTEEFAKRITLGRLSEPEDVAACVSFLAGPDSDYM 242 Query: 248 TGHSYFVDAG 257 TG S +D G Sbjct: 243 TGQSLLIDGG 252 Lambda K H 0.321 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 146 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 256 Length adjustment: 24 Effective length of query: 235 Effective length of database: 232 Effective search space: 54520 Effective search space used: 54520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory