GapMind for catabolism of small carbon sources

 

Protein WP_053545961.1 in Corynebacterium deserti GIMN1.010

Annotation: NCBI__GCF_001277995.1:WP_053545961.1

Length: 503 amino acids

Source: GCF_001277995.1 in NCBI

Candidate for 20 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
myo-inositol catabolism iolT hi Myo-Inositol (Km=0.45mM) uptake porter, IolT2 (Krings et al., 2006).  Can not transport D-glucose (characterized) 87% 100% 857.1 Probable metabolite transport protein CsbC 33% 277.7
D-cellobiose catabolism MFS-glucose med Myo-Inositol uptake porter, IolT1 (Km=0.2mM) (characterized) 55% 99% 516.2 Myo-Inositol (Km=0.45mM) uptake porter, IolT2 (Krings et al., 2006).  Can not transport D-glucose 87% 857.1
D-glucose catabolism MFS-glucose med Myo-Inositol uptake porter, IolT1 (Km=0.2mM) (characterized) 55% 99% 516.2 Myo-Inositol (Km=0.45mM) uptake porter, IolT2 (Krings et al., 2006).  Can not transport D-glucose 87% 857.1
lactose catabolism MFS-glucose med Myo-Inositol uptake porter, IolT1 (Km=0.2mM) (characterized) 55% 99% 516.2 Myo-Inositol (Km=0.45mM) uptake porter, IolT2 (Krings et al., 2006).  Can not transport D-glucose 87% 857.1
D-maltose catabolism MFS-glucose med Myo-Inositol uptake porter, IolT1 (Km=0.2mM) (characterized) 55% 99% 516.2 Myo-Inositol (Km=0.45mM) uptake porter, IolT2 (Krings et al., 2006).  Can not transport D-glucose 87% 857.1
sucrose catabolism MFS-glucose med Myo-Inositol uptake porter, IolT1 (Km=0.2mM) (characterized) 55% 99% 516.2 Myo-Inositol (Km=0.45mM) uptake porter, IolT2 (Krings et al., 2006).  Can not transport D-glucose 87% 857.1
trehalose catabolism MFS-glucose med Myo-Inositol uptake porter, IolT1 (Km=0.2mM) (characterized) 55% 99% 516.2 Myo-Inositol (Km=0.45mM) uptake porter, IolT2 (Krings et al., 2006).  Can not transport D-glucose 87% 857.1
D-xylose catabolism xylT lo D-xylose transporter; D-xylose-proton symporter (characterized) 34% 95% 256.9 Myo-Inositol (Km=0.45mM) uptake porter, IolT2 (Krings et al., 2006).  Can not transport D-glucose 87% 857.1
L-arabinose catabolism araE lo Arabinose/xylose transporter, AraE (characterized) 33% 92% 246.5 Myo-Inositol (Km=0.45mM) uptake porter, IolT2 (Krings et al., 2006).  Can not transport D-glucose 87% 857.1
glycerol catabolism PLT5 lo polyol transporter 5 (characterized) 31% 91% 237.3 Myo-Inositol (Km=0.45mM) uptake porter, IolT2 (Krings et al., 2006).  Can not transport D-glucose 87% 857.1
D-mannitol catabolism PLT5 lo polyol transporter 5 (characterized) 31% 91% 237.3 Myo-Inositol (Km=0.45mM) uptake porter, IolT2 (Krings et al., 2006).  Can not transport D-glucose 87% 857.1
D-ribose catabolism PLT5 lo polyol transporter 5 (characterized) 31% 91% 237.3 Myo-Inositol (Km=0.45mM) uptake porter, IolT2 (Krings et al., 2006).  Can not transport D-glucose 87% 857.1
D-sorbitol (glucitol) catabolism SOT lo polyol transporter 5 (characterized) 31% 91% 237.3 Myo-Inositol (Km=0.45mM) uptake porter, IolT2 (Krings et al., 2006).  Can not transport D-glucose 87% 857.1
xylitol catabolism PLT5 lo polyol transporter 5 (characterized) 31% 91% 237.3 Myo-Inositol (Km=0.45mM) uptake porter, IolT2 (Krings et al., 2006).  Can not transport D-glucose 87% 857.1
D-galactose catabolism galP lo Arabinose-proton symporter; Arabinose transporter (characterized) 31% 96% 235 Myo-Inositol (Km=0.45mM) uptake porter, IolT2 (Krings et al., 2006).  Can not transport D-glucose 87% 857.1
D-fructose catabolism glcP lo D-fructose transporter, sugar porter family (characterized) 33% 93% 226.9 Myo-Inositol (Km=0.45mM) uptake porter, IolT2 (Krings et al., 2006).  Can not transport D-glucose 87% 857.1
sucrose catabolism glcP lo D-fructose transporter, sugar porter family (characterized) 33% 93% 226.9 Myo-Inositol (Km=0.45mM) uptake porter, IolT2 (Krings et al., 2006).  Can not transport D-glucose 87% 857.1
D-fructose catabolism Slc2a5 lo The fructose/xylose:H+ symporter, PMT1 (polyol monosaccharide transporter-1). Also transports other substrates at lower rates. PMT2 is largely of the same sequence and function. Both are present in pollen and young xylem cells (Klepek et al., 2005). A similar ortholog has been identifed in pollen grains of Petunia hybrida (characterized) 32% 92% 222.6 Myo-Inositol (Km=0.45mM) uptake porter, IolT2 (Krings et al., 2006).  Can not transport D-glucose 87% 857.1
sucrose catabolism Slc2a5 lo The fructose/xylose:H+ symporter, PMT1 (polyol monosaccharide transporter-1). Also transports other substrates at lower rates. PMT2 is largely of the same sequence and function. Both are present in pollen and young xylem cells (Klepek et al., 2005). A similar ortholog has been identifed in pollen grains of Petunia hybrida (characterized) 32% 92% 222.6 Myo-Inositol (Km=0.45mM) uptake porter, IolT2 (Krings et al., 2006).  Can not transport D-glucose 87% 857.1
myo-inositol catabolism HMIT lo Proton myo-inositol cotransporter; H(+)-myo-inositol cotransporter; Hmit; H(+)-myo-inositol symporter; Solute carrier family 2 member 13 (characterized) 35% 60% 200.3 Myo-Inositol (Km=0.45mM) uptake porter, IolT2 (Krings et al., 2006).  Can not transport D-glucose 87% 857.1

Sequence Analysis Tools

View WP_053545961.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MTNIKAPTSAPSRQGAAAPTSGTPARRLGQISLVACLGGLLFGYDTGVANGAEGHMAQEL
GLNVFQLGVVISSLVFAAALGALFAGRISDAVGRRKAIILLSGLFFFGSIMVVFSPAGEL
GQFYGPGFAVLVTGRIMLGLAVGGASTVVPVYLAELAPLEIRGSLTGRNELAIVAGQLLA
FVINAIIAVTLHGVVDGIWRIMFAVCALPAIALFFGMLRMPESPRWLVNQGRYDEARRVM
ETVRTPQRAQEEMDEIISVHSENNKKLLGIPEVSQGNAHMSLKDVLSNKWLVRLLIAGIG
VAVAQQLTGINAIMYYGTRVLEESGMSAEMAVIANIAFGAVAVIGGLIALRNMDRLDRRT
TFIIGLSLTTTFHILIAIAGTLLPEGNAVRPFAIMILVVGFVLSMQTFLNVAVWVWLAEI
FPVRMKGIGTGIAVFCGWGVNGVLALFFPALVSGVGITVSFLIFAVVGAIALAFVAKFVP
ETRGRSLEELDHAIFSGKIFQRS

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory