GapMind for catabolism of small carbon sources

 

Protein WP_082353324.1 in Corynebacterium deserti GIMN1.010

Annotation: NCBI__GCF_001277995.1:WP_082353324.1

Length: 468 amino acids

Source: GCF_001277995.1 in NCBI

Candidate for 16 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-alanine catabolism cycA hi D-serine/D-alanine/glycine transporter (characterized) 65% 98% 617.5 Proline-specific permease (ProY) 40% 352.4
D-serine catabolism cycA hi D-serine/D-alanine/glycine transporter (characterized) 65% 98% 617.5 Proline-specific permease (ProY) 40% 352.4
L-alanine catabolism cycA hi D-serine/D-alanine/glycine transporter (characterized) 65% 98% 617.5 Proline-specific permease (ProY) 40% 352.4
L-threonine catabolism RR42_RS28305 med D-serine/D-alanine/glycine transporter (characterized, see rationale) 47% 94% 425.2 D-serine/D-alanine/glycine transporter 65% 617.5
L-proline catabolism proY med Proline-specific permease (ProY) (characterized) 40% 97% 352.4 D-serine/D-alanine/glycine transporter 65% 617.5
L-tryptophan catabolism aroP med Aromatic amino acid transport protein AroP (characterized, see rationale) 40% 99% 350.5 D-serine/D-alanine/glycine transporter 65% 617.5
L-histidine catabolism permease med histidine permease (characterized) 41% 95% 342 D-serine/D-alanine/glycine transporter 65% 617.5
L-tyrosine catabolism aroP med L-tyrosine transporter (characterized) 40% 96% 342 D-serine/D-alanine/glycine transporter 65% 617.5
L-serine catabolism serP med Serine transporter, SerP2 or YdgB, of 459 aas and 12 TMSs (Trip et al. 2013). Transports L-alanine (Km = 20 μM), D-alanine (Km = 38 μM), L-serine, D-serine (Km = 356 μM) and glycine (Noens and Lolkema 2015). The encoding gene is adjacent to the one encoding SerP1 (TC# 2.A.3.1.21) (characterized) 40% 96% 329.7 D-serine/L-alanine/D-alanine/glycine/D-cycloserine uptake porter of 556 aas, CycA 57% 558.9
L-phenylalanine catabolism aroP lo Aromatic amino acid transport protein AroP (characterized, see rationale) 40% 98% 345.9 D-serine/D-alanine/glycine transporter 65% 617.5
phenylacetate catabolism H281DRAFT_04042 lo Aromatic amino acid transporter AroP (characterized, see rationale) 38% 96% 337.4 D-serine/D-alanine/glycine transporter 65% 617.5
L-asparagine catabolism ansP lo L-asparagine permease; L-asparagine transport protein (characterized) 36% 92% 321.6 D-serine/D-alanine/glycine transporter 65% 617.5
L-threonine catabolism serP1 lo Serine uptake transporter, SerP1, of 259 aas and 12 TMSs (Trip et al. 2013). L-serine is the highest affinity substrate (Km = 18 μM), but SerP1 also transports L-threonine and L-cysteine (Km values = 20 - 40 μM) (characterized) 37% 98% 305.8 D-serine/D-alanine/glycine transporter 65% 617.5
L-arginine catabolism rocE lo Probable lysine/arginine permease CAN3; Basic amino acids permease CAN3 (characterized) 30% 83% 186.4 D-serine/D-alanine/glycine transporter 65% 617.5
L-lysine catabolism lysP lo Probable lysine/arginine permease CAN3; Basic amino acids permease CAN3 (characterized) 30% 83% 186.4 D-serine/D-alanine/glycine transporter 65% 617.5
L-tryptophan catabolism TAT lo tryptophan permease (characterized) 31% 66% 173.3 D-serine/D-alanine/glycine transporter 65% 617.5

Sequence Analysis Tools

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSDNAAPDTHLHRGLSNRHLQLIAIGGAIGTGLFMGSGKTISVAGPSVILVYAIIGFMLF
FVMRAMGELLLANLNYKSLRDAVSDILGPGAGFVTGWTYWFCWIATGMADIVAITGYTQY
WWPEIPLWLPGVLTIIVLFALNLAAVRLFGEMEFWFAIIKIVAIVALIAVGFFMVITAFG
APNGTTASFNNLIEHGGFFPNGITGFLAGFQIAIFAFVGIELAGTAAAETKDPETTLPRA
INSIPIRIVVFYVLALAVIMMVTPWNEVSPDNSPFVQMFALAGIPAAAGIINFVVITSAA
SSANSGIFSTSRMLYGLSLEGAAPKRWGVLSKRQVPARGLTFSVLCLIPAVGLLYAGGTV
IEAFTLITTVSSVLFMVVWSYILVAYIVYRRRNPELHEKSVFKMPGGVVMAVVVLVFFVA
MLGVLSLETDTRTALLATPVWFIILGVGWFATGGAKGAQRRIQIHERV

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory