Align ABC transporter for D-Alanine, ATPase component (characterized)
to candidate WP_053545600.1 CDES_RS11255 phosphate ABC transporter ATP-binding protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_5405 (254 letters) >NCBI__GCF_001277995.1:WP_053545600.1 Length = 257 Score = 137 bits (345), Expect = 2e-37 Identities = 86/251 (34%), Positives = 132/251 (52%), Gaps = 16/251 (6%) Query: 15 IQMQGVNKWYGQFHVLKDINLNVKQGERIVLCGPSGSGKSTTIRCLNRLEE-----HQQG 69 +++ VN +YG FH ++++NL V GPSG GKST +R +NR+ E + +G Sbjct: 4 LKLNDVNIYYGDFHAVQNVNLEVPARSVTAFIGPSGCGKSTVLRSINRMHEVTPGAYVKG 63 Query: 70 RIVVDGVELTNDLKQIEAIRREVGMVFQHFNLFPHLTILQNCTLAPMWVRKMPKRKAEEI 129 I++DG + A+R +GMVFQ N FP ++I N + K++ +E+ Sbjct: 64 EILLDGENIYGSKVDPVAVRNTIGMVFQKANPFPTMSIEDNVVAGLKLSGEKNKKRLKEV 123 Query: 130 AMHYLERVRIPEQAH----KYPGQLSGGQQQRVAIARALCMKPKIMLFDEPTSALDPEMV 185 A L + E+ K G LSGGQQQR+ IARA+ ++P+I+L DEP SALDP Sbjct: 124 AEKSLRGANLWEEVKDRLDKPGGGLSGGQQQRLCIARAIAVEPEILLMDEPCSALDPIST 183 Query: 186 KEVLDTMIGLAEDGMTMLCVTHEMGFARTVANRVIFMD------KGEIVEQAAPNDFFDN 239 V D + L E+ T++ VTH M A V+++ F G +VE F++ Sbjct: 184 LAVEDLIHELKEE-FTIVIVTHNMQQAARVSDQTAFYSLEATGRPGRLVEIGPTKKIFES 242 Query: 240 PQNDRTKLFLS 250 P T+ ++S Sbjct: 243 PDQKETEDYIS 253 Lambda K H 0.322 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 257 Length adjustment: 24 Effective length of query: 230 Effective length of database: 233 Effective search space: 53590 Effective search space used: 53590 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory