Align Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized)
to candidate WP_053544231.1 CDES_RS03150 methionine ABC transporter ATP-binding protein
Query= TCDB::P0AAG3 (241 letters) >NCBI__GCF_001277995.1:WP_053544231.1 Length = 360 Score = 167 bits (424), Expect = 2e-46 Identities = 93/226 (41%), Positives = 143/226 (63%), Gaps = 3/226 (1%) Query: 17 LTDCSTEVKKGEVVVVCGPSGSGKSTLIKTVNGLEPVQQGEITVDGI-VVNDKKTDLAKL 75 L + + V+ GEV+ + G SG+GKSTL++ +NGL+ G + ++G +V ++ L KL Sbjct: 45 LDNVTLTVEPGEVIGIIGYSGAGKSTLVRLINGLDSPTSGSLLLNGTDIVGMSESKLRKL 104 Query: 76 RSRVGMVFQHFELFPHLSIIENLTLAQVKVLKRDKAPAREKALKLLERVGLSAHANKFPA 135 RS +GM+FQ F LF + N+ ++V K DKA + + ++LE VGL +P Sbjct: 105 RSNIGMIFQQFNLFQSRTAAGNVEYP-LEVAKMDKAARKARVQEMLEFVGLGDKGKNYPE 163 Query: 136 QLSGGQQQRVAIARALCMDPIAMLFDEPTSALDPEMINEVLDVMVELANE-GMTMMVVTH 194 QLSGGQ+QRV IARAL +P +L DE TSALDPE +EVL+++ ++ E G+T++V+TH Sbjct: 164 QLSGGQKQRVGIARALATNPTLLLADEATSALDPETTHEVLELLRKVNRELGITIVVITH 223 Query: 195 EMGFARKVANRVIFMDEGKIVEDSPKDAFFDDPKSDRAKDFLAKIL 240 EM R +A++V M+ GK+VE F +P++ A+ F+A L Sbjct: 224 EMEVVRSIADKVAVMESGKVVEFGSVYEVFSNPQTQVAQRFVATAL 269 Lambda K H 0.320 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 173 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 360 Length adjustment: 26 Effective length of query: 215 Effective length of database: 334 Effective search space: 71810 Effective search space used: 71810 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory