Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate WP_053545600.1 CDES_RS11255 phosphate ABC transporter ATP-binding protein
Query= TCDB::Q52666 (263 letters) >NCBI__GCF_001277995.1:WP_053545600.1 Length = 257 Score = 138 bits (347), Expect = 1e-37 Identities = 87/255 (34%), Positives = 140/255 (54%), Gaps = 16/255 (6%) Query: 23 IQISQMNKWYGQFHVLRDINLTVHRGERIVIAGPSGSGKSTMIRCINRLEE-----HQSG 77 ++++ +N +YG FH ++++NL V GPSG GKST++R INR+ E + G Sbjct: 4 LKLNDVNIYYGDFHAVQNVNLEVPARSVTAFIGPSGCGKSTVLRSINRMHEVTPGAYVKG 63 Query: 78 KIIVDGIELTSDLKNIDKVRSEVGMVFQHFNLFPHLTILENLTLAPIWVRKVPKREAEET 137 +I++DG + + VR+ +GMVFQ N FP ++I +N+ + K+ +E Sbjct: 64 EILLDGENIYGSKVDPVAVRNTIGMVFQKANPFPTMSIEDNVVAGLKLSGEKNKKRLKEV 123 Query: 138 AMYYLEKVKIPEQAQ----KYPGQLSGGQQQRVAIARSLCMKPKIMLFDEPTSALDPEMI 193 A L + E+ + K G LSGGQQQR+ IAR++ ++P+I+L DEP SALDP Sbjct: 124 AEKSLRGANLWEEVKDRLDKPGGGLSGGQQQRLCIARAIAVEPEILLMDEPCSALDPIST 183 Query: 194 KEVLDTMIQLAEEGMTMLCVTHEMGFAQAVANRVIFMA------DGQIVEQNNPHDFFHN 247 V D + +L EE T++ VTH M A V+++ F + G++VE F + Sbjct: 184 LAVEDLIHELKEE-FTIVIVTHNMQQAARVSDQTAFYSLEATGRPGRLVEIGPTKKIFES 242 Query: 248 PQSERTKQFLSQILG 262 P + T+ ++S G Sbjct: 243 PDQKETEDYISGRFG 257 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 173 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 257 Length adjustment: 24 Effective length of query: 239 Effective length of database: 233 Effective search space: 55687 Effective search space used: 55687 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory