Align PEB1C, component of Uptake system for glutamate and aspartate (characterized)
to candidate WP_053544231.1 CDES_RS03150 methionine ABC transporter ATP-binding protein
Query= TCDB::A3ZI83 (242 letters) >NCBI__GCF_001277995.1:WP_053544231.1 Length = 360 Score = 178 bits (452), Expect = 1e-49 Identities = 98/248 (39%), Positives = 152/248 (61%), Gaps = 8/248 (3%) Query: 2 IELKNVNKYYGTHH-----VLKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSG 56 +E + V+K + + L N+ L+V+ GE + IIG SG+GKST +R +NGL+ +SG Sbjct: 25 VEFRGVSKVFSNNKSAKTTALDNVTLTVEPGEVIGIIGYSGAGKSTLVRLINGLDSPTSG 84 Query: 57 EVVVN--NLVLNHKNKIEICRKYCAMVFQHFNLYPHMTVLQNLTLAPMKLQKKSKKEAEE 114 +++N ++V ++K+ R M+FQ FNL+ T N+ P+++ K K + Sbjct: 85 SLLLNGTDIVGMSESKLRKLRSNIGMIFQQFNLFQSRTAAGNVEY-PLEVAKMDKAARKA 143 Query: 115 TAFKYLKVVGLLDKANVYPATLSGGQQQRVAIARSLCTKKPYILFDEPTSALDPETIQEV 174 + L+ VGL DK YP LSGGQ+QRV IAR+L T +L DE TSALDPET EV Sbjct: 144 RVQEMLEFVGLGDKGKNYPEQLSGGQKQRVGIARALATNPTLLLADEATSALDPETTHEV 203 Query: 175 LDVMKEISHQSNTTMVVVTHEMGFAKEVADRIIFMEDGAIVEENIPSEFFSNPKTERARL 234 L+++++++ + T+VV+THEM + +AD++ ME G +VE E FSNP+T+ A+ Sbjct: 204 LELLRKVNRELGITIVVITHEMEVVRSIADKVAVMESGKVVEFGSVYEVFSNPQTQVAQR 263 Query: 235 FLGKILKN 242 F+ L+N Sbjct: 264 FVATALRN 271 Lambda K H 0.317 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 360 Length adjustment: 26 Effective length of query: 216 Effective length of database: 334 Effective search space: 72144 Effective search space used: 72144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory