Align Ketoglutarate semialdehyde dehydrogenase (EC 1.2.1.26) (characterized)
to candidate WP_082353398.1 CDES_RS06155 CoA-acylating methylmalonate-semialdehyde dehydrogenase
Query= reanno::Smeli:SM_b20891 (477 letters) >NCBI__GCF_001277995.1:WP_082353398.1 Length = 513 Score = 275 bits (702), Expect = 3e-78 Identities = 159/451 (35%), Positives = 235/451 (52%), Gaps = 3/451 (0%) Query: 22 NPSNTDDVVGEYARASAEDAKAAIAAAKAAFPAWSRSGILERHAILKKTADEILARKDEL 81 NP+ T V A+ AA++AA+A PAW +G+ R A++ K + I +RKDEL Sbjct: 44 NPA-TGAVTASLPFATTATVNAAVSAAQAVAPAWRATGLARRAAVMFKLHEIITSRKDEL 102 Query: 82 GRLLSREEGKTLAEGIGETVRAGQIFEFFAGETLRLAGEVVPSVRPGIGVEITREPAGVV 141 L++ E+GK L++ GE R + EF AG + GE + G+ V R+P GVV Sbjct: 103 AALITEEQGKVLSDAAGEIARGLENVEFCAGLVHHMKGEFLEQAAAGLDVHQVRQPLGVV 162 Query: 142 GIITPWNFPIAIPAWKLAPALCYGNTIVFKPAELVPGCSWAIVDILHRAGLPKGVLNLVM 201 ITP+NFP +P W + A+ GNT+V KP+E P IV+ H AGLP+GVLNL+ Sbjct: 163 ACITPFNFPAMVPLWMITTAIAAGNTVVLKPSEKDPSAVNWIVEAFHEAGLPEGVLNLIH 222 Query: 202 GKGSVVGQAMLDSPDVQAITFTGSTATGKRVAVASVEHNRKYQLEMGGKNPFVVLDDADL 261 G V +A++D P VQA++F GST + + + ++ Q G KN VV+ DADL Sbjct: 223 GDREAV-EALIDDPRVQAVSFVGSTPIAQSIYTRATALGKRVQALGGAKNHMVVMPDADL 281 Query: 262 SVAVEAAVNSAFFSTGQRCTASSRIIVTEGIHDRFVAAMGERIKGLVVDDALKPGTHIGP 321 A +AAV++ + + G+RC A S ++ I D +A + RI L + + P + +GP Sbjct: 282 DAAADAAVSAGYGAAGERCMAISVVVPVGDIADDLIAKISSRITDLTIGEGTDPDSEMGP 341 Query: 322 VVDQSQLNQDTDYIAIGKQEGAKLAFGGEVISRDTPGFYLQPALFTEATNEMRISREEIF 381 V+ + + IA GA++ G + GF++ P L M + EEIF Sbjct: 342 VITSAAKERIEGLIAGSSDSGAEVVVDGRSVDLPDEGFFIGPTLIDHVKPGMPVYDEEIF 401 Query: 382 GPVAAVIRVKDYDEALAVANDTPFGLSSGIATTSLKHATHFKRNAEAGMVMVNLPTAGVD 441 GPV +V RV +DEA+ + N + + I T + A F+ E GMV +N+P Sbjct: 402 GPVLSVARVGHFDEAVELINSCQYANGTAIFTRDGRTAREFEFAIEVGMVGINVPIPVPI 461 Query: 442 FHVPFGGRKASSYGPREQ-GKYAAEFYTNVK 471 FGG K S +G G + FYT K Sbjct: 462 GAFSFGGWKKSLFGDTHMYGPESFNFYTRRK 492 Lambda K H 0.317 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 600 Number of extensions: 31 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 477 Length of database: 513 Length adjustment: 34 Effective length of query: 443 Effective length of database: 479 Effective search space: 212197 Effective search space used: 212197 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory