Align GluD aka CGL1953, component of Glutamate porter (characterized)
to candidate WP_053545122.1 CDES_RS08410 amino acid ABC transporter permease
Query= TCDB::P48245 (273 letters) >NCBI__GCF_001277995.1:WP_053545122.1 Length = 228 Score = 91.7 bits (226), Expect = 1e-23 Identities = 63/196 (32%), Positives = 102/196 (52%), Gaps = 12/196 (6%) Query: 26 ILPGLWGTLKSAVFSVILALVMGTALGLGRISEIRILRWFCAVIIETFRAIPVLILMIF- 84 +LP W T+K ++S I A+++GT L R+S ++ILR I T R P+ ++++F Sbjct: 12 LLPAFWVTIKLTIYSAIGAMILGTILTAMRVSPVKILRTLSTAYINTVRNTPLTLVVLFC 71 Query: 85 AYQMFAQYNIV-----PSSQLA---FAAVVFGLTMYNGSVIAEILRSGIASLPKGQKEAA 136 ++ ++ + S+ LA F V G +Y + +AE LRSGI ++ GQ EAA Sbjct: 72 SFGLYQNLGMTLAGRDSSTFLADNNFRLAVLGFILYTSTFVAESLRSGINTVHFGQAEAA 131 Query: 137 IALGMSSRQTTWSILLPQAVAAMLPALISQMVIALKDSALGYQIGYIEVVRSGIQSASVN 196 +LG+ T SI+ PQAV A + L + ++ K++ + IG V + + S Sbjct: 132 RSLGLGFGDTFRSIIFPQAVRAAIVPLGNTLIALTKNTTIASVIG---VGEASLLMKSTI 188 Query: 197 RNYLAALFVVALIMIV 212 N+ LFVV I V Sbjct: 189 ENHANMLFVVFSIFAV 204 Lambda K H 0.323 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 228 Length adjustment: 24 Effective length of query: 249 Effective length of database: 204 Effective search space: 50796 Effective search space used: 50796 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory