Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate WP_053544712.1 CDES_RS05950 phosphoglycerate dehydrogenase
Query= BRENDA::Q9I530 (329 letters) >NCBI__GCF_001277995.1:WP_053544712.1 Length = 530 Score = 152 bits (384), Expect = 2e-41 Identities = 92/257 (35%), Positives = 137/257 (53%), Gaps = 19/257 (7%) Query: 65 AAGGTRLVALRSAGYNHVDLAAAEALGLPVVHVPAYSPHAVAEHAVGLILTLNRRLHRAY 124 AA ++V G ++VD+ AA G+ V + P + H+ EHA+ L+L+ R++ A Sbjct: 65 AAPNLKIVGRAGVGLDNVDIPAATEAGVMVANAPTSNIHSACEHAISLLLSTARQIPAAD 124 Query: 125 NRTREGDFSLHGLTGFDLHGKRVGVIGTGQIGETFARIMAGFGCELLAYDPYPNP-RIQA 183 R+G++ G ++ GK VG++G G IG+ FA+ +A F ++AYDPY NP R Sbjct: 125 ATLRDGEWKRSSFNGVEIFGKTVGIVGFGHIGQLFAQRLAAFETTIIAYDPYANPARAAQ 184 Query: 184 LGGRYLALDALLAESDIVSLHCPLTADTRHLIDAQRLATMKPGAMLINTGRGALVNAAAL 243 L + LD L++ SD V++H P T +T + DA+ LA K G ++IN RG LV+ AL Sbjct: 185 LNVELVELDELMSRSDFVTIHLPKTKETAGMFDAELLAKSKKGQIIINAARGGLVDEQAL 244 Query: 244 IEALKSGQLGYLGLDVYEEEADIFFEDRSDQPLQDDVLARLLSFPNVVVTAHQAFLTREA 303 +A++SG + G DVY E P D L +L P VVVT H T EA Sbjct: 245 ADAIESGHIRGAGFDVYATE-----------PCTDSPLFKL---PQVVVTPHLGASTVEA 290 Query: 304 L----AAIADTTLDNIA 316 +AD+ L +A Sbjct: 291 QDRAGTDVADSVLKALA 307 Lambda K H 0.323 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 385 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 530 Length adjustment: 31 Effective length of query: 298 Effective length of database: 499 Effective search space: 148702 Effective search space used: 148702 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory