Align D-specific alpha-keto acid dehydrogenase; Vancomycin resistance protein VanH; EC 1.1.1.- (characterized)
to candidate WP_053545450.1 CDES_RS10310 hypothetical protein
Query= SwissProt::Q05709 (322 letters) >NCBI__GCF_001277995.1:WP_053545450.1 Length = 304 Score = 104 bits (259), Expect = 3e-27 Identities = 78/220 (35%), Positives = 118/220 (53%), Gaps = 22/220 (10%) Query: 105 DSVADYTMMLILMAVRNVKSIVRSVEKHDFRLDSDRGKVL--SDMTVGVVGTGQIGKAVI 162 D+VA+ T+ L+L + RS + D R ++ KV + TV ++G G IG ++ Sbjct: 84 DTVAESTIGLLLAQLHYHSLTCRS-KTWDVRSTVEQRKVWLHDNKTVAILGAGGIGVRLV 142 Query: 163 ERLRGFGCKVLAYSRS-RSIEVNYVPF-----DELLQNSDIVTLHVPLNTDTHYIISHEQ 216 E L+ F K +A + S R +E F D + +DI L +PL T+ I++ E Sbjct: 143 EMLKPFNVKTIAANNSGRPVEGADETFAMKDADHVWAEADIFVLILPLTDATYQIVNAET 202 Query: 217 IQRMKQGAFLINTGRGPLVDTYELVKALENGKLGGAALDVLEGEEEFFYSDCTQKPIDNQ 276 + +MK A ++N GRGPL++T +LV AL+NG + GAALDV + E P+ ++ Sbjct: 203 LGKMKPSAVVVNVGRGPLINTDDLVVALQNGTIAGAALDVTDPE-----------PLPDR 251 Query: 277 FLLKLQRMPNVIITPHTAYYTEQALRDTVEKTIKNCLDFE 316 L M NV+ITPHTA TE+ T E T++N FE Sbjct: 252 H--PLWDMDNVVITPHTANTTERIRALTGELTLRNIELFE 289 Lambda K H 0.319 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 322 Length of database: 304 Length adjustment: 27 Effective length of query: 295 Effective length of database: 277 Effective search space: 81715 Effective search space used: 81715 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory