Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate WP_054034421.1 DFT_RS24610 ABC transporter ATP-binding protein
Query= CharProtDB::CH_088321 (255 letters) >NCBI__GCF_001293685.1:WP_054034421.1 Length = 270 Score = 166 bits (421), Expect = 4e-46 Identities = 95/235 (40%), Positives = 135/235 (57%), Gaps = 1/235 (0%) Query: 17 VLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVFLGDNPINMLSSRQLAR 76 VL D+S +PTG +IGPNG GK+TLL + LL Q+G + + I ++R+LAR Sbjct: 24 VLADLSFQVPTGGFFIIIGPNGSGKTTLLKLTAGLLTVQAGQIAVHSRAIGDYTARELAR 83 Query: 77 RLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVNVAMNQTRINHLAVRRL 136 R++ +PQ TV ++V GR P L + G +D + AM + HLA RRL Sbjct: 84 RMAYVPQSVPVTFAFTVLQVVMMGRAPHLGMLGFEGEQDLTQAWEAMQLAGVAHLADRRL 143 Query: 137 TELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVDLMRLMGELRT-QGKTVVAVL 195 +LSGG+RQR F+A + Q ++LLDEPT LD+ HQV +M LM L+T +G TVV V Sbjct: 144 DQLSGGERQRVFIARAICQQPEIMLLDEPTAALDLAHQVRVMDLMARLKTEEGMTVVMVS 203 Query: 196 HDLNQASRYCDQLVVMANGHVMAQGTPEEVMTPGLLRTVFSVEAEIHPEPVSGRP 250 HDLN A+ Y D+L+++ G + G P EV+ LL V+ + P+ P Sbjct: 204 HDLNLAAMYADRLLLLDRGRLAGIGPPAEVLRFDLLERVYGCTLLVDKSPLGDYP 258 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 270 Length adjustment: 25 Effective length of query: 230 Effective length of database: 245 Effective search space: 56350 Effective search space used: 56350 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory