GapMind for catabolism of small carbon sources

 

Alignments for a candidate for aldox-small in Desulfatitalea tepidiphila S28bF

Align glycolaldehyde oxidoreductase small subunit (characterized)
to candidate WP_083453266.1 DFT_RS25370 2Fe-2S iron-sulfur cluster binding domain-containing protein

Query= metacyc::MONOMER-18073
         (163 letters)



>NCBI__GCF_001293685.1:WP_083453266.1
          Length = 474

 Score =  156 bits (395), Expect = 4e-43
 Identities = 72/126 (57%), Positives = 92/126 (73%)

Query: 32  VDFLREELGLTGTKIGCDTTTCGACTVLLNGKSVKSCTLFAVQADGAEITTIEGLSVDSK 91
           VD LRE+LGLTGTK GC T  CGACT+L++G+S  SC +   Q +G +ITTIEGL+    
Sbjct: 23  VDLLREDLGLTGTKEGCGTGECGACTILVDGRSRLSCLMLVPQLEGRKITTIEGLAPGEH 82

Query: 92  LHPIQEAFKENFALQCGFCTPGMIMQAYFLLKENPNPSEEEVRDGLHGNICRCTGYQNIV 151
           LHP+Q AF  + A+QCGFCTPGM++ A  LL  +P P  +EV + + GN+CRCTGYQ IV
Sbjct: 83  LHPVQAAFVRHGAVQCGFCTPGMVLTAVDLLARHPEPRHDEVIEAVSGNLCRCTGYQKIV 142

Query: 152 KAVLDA 157
            AV+DA
Sbjct: 143 SAVMDA 148


Lambda     K      H
   0.322    0.138    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 197
Number of extensions: 7
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 163
Length of database: 474
Length adjustment: 25
Effective length of query: 138
Effective length of database: 449
Effective search space:    61962
Effective search space used:    61962
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 47 (22.7 bits)

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory