Align Iron-sulfur cluster-binding protein, putative (characterized, see rationale)
to candidate WP_053936339.1 WG78_RS03185 NADH-quinone oxidoreductase subunit G
Query= uniprot:Q39TW6 (218 letters) >NCBI__GCF_001294205.1:WP_053936339.1 Length = 768 Score = 94.7 bits (234), Expect = 4e-24 Identities = 65/204 (31%), Positives = 95/204 (46%), Gaps = 30/204 (14%) Query: 4 INLQIDGKEVVATEGMTILDAAKSVGISIPTLCHHEKLEPYGGCRICTVEVEVRGWPKLV 63 + ++IDGK++ G T++DAA SVG IP C+H+KL CR+C V+VE PK + Sbjct: 2 LEVEIDGKKLTVPGGSTVMDAANSVGAYIPHFCYHKKLSIAANCRMCLVQVEKA--PKPL 59 Query: 64 AGCIYPVEKGLVVRTRNEKIDKIRKVLLEEMLAHAP---------DSEELKALAQEYGAD 114 C PV G+ V T ++ K + ++E +L + P +L+ LA YG Sbjct: 60 PACATPVTDGMKVWTHSDSAVKAQAGVMEFLLINHPLDCPICDQGGECQLQDLAVGYGKS 119 Query: 115 RDRFEKHP----------------SFCIHCGLCVRYCAEIKKKNAVGFVDRGSNREI-SF 157 R+E+ + CIHC CVR+ E+ +G RG + EI SF Sbjct: 120 ASRYEEEKRSVVNKNLGPLISTDMTRCIHCTRCVRFTEEVAGYQELGMPGRGEHSEIMSF 179 Query: 158 IPEIAAKECWDCKECFPLCPTSAL 181 I + E LCP AL Sbjct: 180 IGKTVNSEI--SGNVIDLCPVGAL 201 Lambda K H 0.320 0.137 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 313 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 218 Length of database: 768 Length adjustment: 31 Effective length of query: 187 Effective length of database: 737 Effective search space: 137819 Effective search space used: 137819 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory