Align ABC transporter for D-Alanine, permease component 1 (characterized)
to candidate WP_053937456.1 WG78_RS08860 amino acid ABC transporter permease
Query= reanno::pseudo6_N2E2:Pf6N2E2_5404 (365 letters) >NCBI__GCF_001294205.1:WP_053937456.1 Length = 221 Score = 115 bits (288), Expect = 1e-30 Identities = 66/215 (30%), Positives = 117/215 (54%), Gaps = 10/215 (4%) Query: 149 AVATSQWGGLM----LTLVIATVGIVGALPLGIVLALGRRSNMPAIRVVCVTFIEFWRGV 204 A+ S W L+ TL+ A +VG L +G +LA+ R S + A++ ++ RG Sbjct: 5 ALLQSAWPYLLKGTGYTLLFAVGAMVGGLLVGALLAVLRLSGIKALQWPAALYVSAMRGT 64 Query: 205 PLITVLFMSSVMLPLFLPEGMNFDKLLRALIGVILFQSAYIAEVVRGGLQAIPKGQYEAA 264 PL+ +F+ LP G+ F+ + ++ + L AY++E +RG + + +GQ+EAA Sbjct: 65 PLLVQIFIIYYGLPAI---GIQFEPITAGILALSLNTGAYVSETMRGAINGVDRGQWEAA 121 Query: 265 AAMGLGYWRSMGLVILPQALKLVIPGIVNTFIALFKDTSLVIIIGLFDLLNSVKQAAADP 324 + G+G W+++ ++ PQAL+L +P + N+ I+L KDTSLV +I + +L+ + K+ + Sbjct: 122 FSQGMGRWQTLHYIVWPQALRLAVPSLSNSLISLIKDTSLVSVIAVTELMLATKEVIST- 180 Query: 325 KWLGMATEGYVFAALVFWIFCFGMSRYSMHLERKL 359 YV AA ++W + LER+L Sbjct: 181 --TFQPFPLYVAAAAIYWCLSLIFEQVQRLLERRL 213 Lambda K H 0.330 0.144 0.469 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 246 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 221 Length adjustment: 26 Effective length of query: 339 Effective length of database: 195 Effective search space: 66105 Effective search space used: 66105 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory