Align ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, permease component 2 (characterized)
to candidate WP_083459206.1 WG78_RS15275 amino acid ABC transporter permease
Query= reanno::pseudo3_N2E3:AO353_16285 (248 letters) >NCBI__GCF_001294205.1:WP_083459206.1 Length = 266 Score = 99.8 bits (247), Expect = 5e-26 Identities = 71/236 (30%), Positives = 112/236 (47%), Gaps = 15/236 (6%) Query: 21 YLDWFITGLGWTIAIAIVAWIIALMLGSVLGVMRT---------VPNRLV-SGIATCYVE 70 Y FI G T+ I +A I+ ++G G+ R P RL+ AT YV Sbjct: 28 YRQMFIDGTKMTLLITFIAVILGTLIGLFAGMARLSDIKHGPWKYPVRLLLRWPATIYVT 87 Query: 71 LFRNVPLLVQLFIWYFLVPDLLPQN-----LQDWYKQDLNPTTSAYLSVVVCLGLFTAAR 125 FR PL VQ+ + +F V LL + L A++S +V L L A Sbjct: 88 FFRGTPLFVQILLIHFAVMPLLVHPTDGLLISGDLATSLRQEYGAFMSGLVALTLNAGAY 147 Query: 126 VCEQVRTGIQALPRGQESAARAMGFKLPQIYWNVLLPQAYRIVIPPLTSEFLNVFKNSSV 185 + E R GIQ++ RGQ A+R++G Q V++PQA+R ++PPL +E + + K+SS+ Sbjct: 148 ITEIFRAGIQSIARGQTEASRSLGMNYWQSMRYVVVPQAFRRMLPPLGNEAIMLLKDSSL 207 Query: 186 ASLIGLMELLAQTKQTAEFSANLFEAFTLATLIYFTLNMSLMLLMRMVEKKVAVPG 241 S+IG +L + A + +E + IY L M + + +E++ G Sbjct: 208 ISVIGFADLAYAARTVAGVYSRFWEPYLTIAFIYLILTMVMAAGVARLERRFHATG 263 Lambda K H 0.326 0.139 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 159 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 266 Length adjustment: 24 Effective length of query: 224 Effective length of database: 242 Effective search space: 54208 Effective search space used: 54208 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory