Align PEP1B, component of Uptake system for glutamate and aspartate (characterized)
to candidate WP_053938864.1 WG78_RS16135 amino acid ABC transporter permease
Query= TCDB::A1VZQ3 (250 letters) >NCBI__GCF_001294205.1:WP_053938864.1 Length = 248 Score = 129 bits (324), Expect = 6e-35 Identities = 74/216 (34%), Positives = 120/216 (55%), Gaps = 13/216 (6%) Query: 42 DAFINGFIYTLEVSILALLIATIFGTIGGVMATSRFKIIRAYTRIYVELFQNVPLVIQIF 101 D F +G TL +++ +IA + GT+ GVM T K++ YV+LF+NVPL++Q+F Sbjct: 23 DWFFSGLAMTLGLALAGWIIALVLGTVLGVMRTLPGKVLPRIAGAYVDLFRNVPLLVQLF 82 Query: 102 FLFYALP-----VLG--IRLDI------FTIGVLGVGAYHGAYVSEVVRSGILAVPRGQF 148 +Y +P +G ++ DI F ++ +G + A V E VR+GI A+PRGQ Sbjct: 83 IWYYVIPDWLPDAIGNWLKQDISPTTNAFITVMVCLGLFTAARVCEQVRTGIQALPRGQA 142 Query: 149 EASASQGFTYIQQMRYIIVPQTIRIILPPMTNQMVNLIKNTSVLLIVGGAELMHSADSYA 208 A + G +Q R+I+VPQ RII+PP+T++ +N+IKN+SV +V EL+ Sbjct: 143 NAGYALGLNIVQVYRHIVVPQAFRIIIPPLTSEFLNIIKNSSVASLVALPELLGQTKQLV 202 Query: 209 ADYGNYAPAYIFAAVLYFIICYPLAYFAKAYENKLK 244 AY ++YF++ L +F + E +L+ Sbjct: 203 DFSAAQFEAYTVGTLIYFVVNIALMFFMRWVEKRLR 238 Lambda K H 0.328 0.143 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 248 Length adjustment: 24 Effective length of query: 226 Effective length of database: 224 Effective search space: 50624 Effective search space used: 50624 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory