Align Fe(3+) dicitrate transport system permease protein FecC; Iron(III) dicitrate transport system permease protein FecC (characterized)
to candidate WP_083458691.1 WG78_RS01660 iron ABC transporter permease
Query= SwissProt::P15030 (332 letters) >NCBI__GCF_001294205.1:WP_083458691.1 Length = 340 Score = 158 bits (399), Expect = 2e-43 Identities = 109/331 (32%), Positives = 167/331 (50%), Gaps = 12/331 (3%) Query: 6 HPVLLWGLPVAALIIIFWLSLFCYSAIPVSGADATRALLPGHTPTLPEALVQN----LRL 61 HP +L L + A +++ L + A+ + A LL H T E L +N +RL Sbjct: 15 HPAMLL-LALLACLLLLALIAAAHGAVAIP-LHALPRLLLAHDLTEQEQLWRNVLVQIRL 72 Query: 62 PRSLVAVLIGASLALAGTLLQTLTHNPMASPSLLGINSGAALAMALTSALSPTPIAGYSL 121 PR +A++ G L + GT +Q L NP+A P L+GI SG AL L + + L Sbjct: 73 PRVALAIVAGGGLTVTGTAMQALFRNPLAEPGLIGIASGGALGAVAAIVLGAPGL--FWL 130 Query: 122 SFIAACGGGVSWLLVMTAGGGFRHTHDRNKLILAGIALSAFCMGLTRITLLLAED-HAYG 180 + A G + L G + + L+LAG+A++ C + + +A+D Sbjct: 131 TPAAFIGSLAATALCYQLG---QRRPGMSSLLLAGVAINVICGSIIGLFTYVADDAQLRS 187 Query: 181 IFYWLAGGVSHARWQDVWQLLPVVVTAVPVVLLLANQLNLLNLSDSTAHTLGVNLTRLRL 240 + +W G ++ A W + L P + ++L LN L L + A LG L LR Sbjct: 188 LTFWNMGSLAGATWTQLAFLGPWTLALSLLLLREWRALNALLLGEREAQHLGFALNPLRR 247 Query: 241 VINMLVLLLVGACVSVAGPVAFIGLLVPHLARFWAGFDQRNVLPVSMLLGATLMLLADVL 300 + +LV L+VG V+ G + F+GL+VPHL R G D R +LP +++ GA + LAD L Sbjct: 248 RLIVLVALIVGPLVAATGVIGFVGLVVPHLVRLSLGADHRWLLPNTLVAGAIALSLADWL 307 Query: 301 ARALAFPGDLPAGAVLALIGSPCFVWLVRRR 331 AR + P +LP G V +LIG P F+W++ RR Sbjct: 308 ARVVVIPAELPIGIVTSLIGGPFFLWILTRR 338 Lambda K H 0.327 0.140 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 366 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 340 Length adjustment: 28 Effective length of query: 304 Effective length of database: 312 Effective search space: 94848 Effective search space used: 94848 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory