Align ABC transporter for L-Arginine and L-Citrulline, permease component 1 (characterized)
to candidate WP_053937456.1 WG78_RS08860 amino acid ABC transporter permease
Query= reanno::pseudo3_N2E3:AO353_03045 (232 letters) >NCBI__GCF_001294205.1:WP_053937456.1 Length = 221 Score = 119 bits (299), Expect = 4e-32 Identities = 70/220 (31%), Positives = 115/220 (52%), Gaps = 17/220 (7%) Query: 7 VIWEALPLYFGGLVTTLKLLALSLLFGLLAALPLGLMRVSKQPIVNMSAWLYTYVIRGTP 66 ++ A P G TL +++ GLL L ++R+S + A LY +RGTP Sbjct: 6 LLQSAWPYLLKGTGYTLLFAVGAMVGGLLVGALLAVLRLSGIKALQWPAALYVSAMRGTP 65 Query: 67 MLVQLFLIYYGLA----QFEAVRESFLWPWLSSATFCACLAFAINTSAYTAEIIAGSLRA 122 +LVQ+F+IYYGL QFE + L A ++NT AY +E + G++ Sbjct: 66 LLVQIFIIYYGLPAIGIQFEPITAGIL-------------ALSLNTGAYVSETMRGAING 112 Query: 123 TPNGEIEAAKAMGMSRFKMYKRILLPSALRRALPQYSNEVIMMLQTTSLASIVTLIDITG 182 G+ EAA + GM R++ I+ P ALR A+P SN +I +++ TSL S++ + ++ Sbjct: 113 VDRGQWEAAFSQGMGRWQTLHYIVWPQALRLAVPSLSNSLISLIKDTSLVSVIAVTELML 172 Query: 183 AARTVNAQYYLPFEAYITAGVFYLCMTFILVRLFKMAEHR 222 A + V + + PF Y+ A Y C++ I ++ ++ E R Sbjct: 173 ATKEVISTTFQPFPLYVAAAAIYWCLSLIFEQVQRLLERR 212 Lambda K H 0.329 0.139 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 119 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 232 Length of database: 221 Length adjustment: 22 Effective length of query: 210 Effective length of database: 199 Effective search space: 41790 Effective search space used: 41790 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory