Align N-succinylglutamate 5-semialdehyde dehydrogenase; EC 1.2.1.71; Succinylglutamic semialdehyde dehydrogenase; SGSD (uncharacterized)
to candidate WP_053938622.1 WG78_RS14820 aldehyde dehydrogenase
Query= curated2:Q1QTQ7 (489 letters) >NCBI__GCF_001294205.1:WP_053938622.1 Length = 498 Score = 206 bits (525), Expect = 1e-57 Identities = 153/476 (32%), Positives = 233/476 (48%), Gaps = 20/476 (4%) Query: 1 MQAKQQLLIDGAWVDGDAAR-FAKTDPVSGETLWTATAASATQVEHAVAAARQAFPD--W 57 +Q + + LIDG + + + F P+ G+ L V+H VA ARQ F W Sbjct: 17 LQIEGRALIDGEFTAAASGKTFDCISPIDGKLLTQVAWCGEADVDHTVAIARQRFESGVW 76 Query: 58 ARRSFAERQAVVERFRECLETHREHLATAIAQETGKPLWEART-EVGAMIGKVAISITAY 116 + + +R+ ++ R+ E + H + +A + GKP+ + T +V V A Sbjct: 77 SDLNPRQRKEIMLRWAELIRVHADEIALLETLDAGKPIGDTTTVDVPGAAYTVQWYAEAI 136 Query: 117 HERTGERARDIGDARAVLRHRPHGVLAVYGPYNFPGHLPNGHIVPALLAGNAVVFKPSEQ 176 + GE A ++ +P GV+A P+NFP + PAL AGN+V+ KPSE+ Sbjct: 137 DKAGGEVAPVDYHLVGLVTRQPIGVVAAVVPWNFPILMAAWKFGPALAAGNSVILKPSEK 196 Query: 177 TPMTADLTLQCWLEAGLPAGVINLVQGAAEVGQALAGSADIDGLLFTGSAKVGGLLHRQF 236 +P++A Q LEAG+P GV N++ G + G+ LA D+D L FTGS VG L + Sbjct: 197 SPLSALRVAQLALEAGIPPGVFNVLPGFGDTGKLLALHMDVDCLAFTGSTFVGKQLMQHS 256 Query: 237 GGQVDKILALELGGNNP-LVVKDVPDREAAVLSILQSAFASGGQRCTCARRLIVPHGAVG 295 G K + LELGG +P +++ D PD A S + F + G+ CT RL+V H +V Sbjct: 257 GQSNLKRVWLELGGKSPNIIMPDCPDMARAARSAAGAIFYNMGEMCTAGSRLLV-HRSVK 315 Query: 296 DDLIDALTSAIAELRVAAPFSEPAPFYAGLTSVEAADGLLA------AQDDLVARGGRPL 349 D+ I AL + A + P +PA + + +++ + L+ GGR L Sbjct: 316 DEFIKALIAEAAAYKPGNPL-DPATSMGAIVDHIQLERVMSYIETGKGEATLLLGGGRTL 374 Query: 350 SRMRRLQAGTSLLSPGLIDVTGCD--VPDEEHFGPLLKVHRYRDWDEAIALANDTRYGLS 407 + + G + P + DV + V EE FGP+L V + DEAIALAN + YGL+ Sbjct: 375 T-----ETGGYYIEPTIFDVASQEARVAAEEIFGPVLSVITFDTLDEAIALANASEYGLA 429 Query: 408 AGLIGGERADWDDFLLRIRAGIVNWNRQTTGASSDAPFGGIGDSGNHRPSAYYAAD 463 A + + + R+RAG V N G + PFGG SGN R + +A D Sbjct: 430 AAIWTADLTTAHEAARRLRAGTVWVNCYDEGGDMNFPFGGFKQSGNGRDKSLHALD 485 Lambda K H 0.319 0.135 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 662 Number of extensions: 35 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 489 Length of database: 498 Length adjustment: 34 Effective length of query: 455 Effective length of database: 464 Effective search space: 211120 Effective search space used: 211120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory