Align 2-keto-3-deoxy-L-fuconate dehydrogenase; EC 1.1.1.- (characterized)
to candidate WP_053939471.1 WG78_RS19265 SDR family oxidoreductase
Query= SwissProt::Q8P3K4 (300 letters) >NCBI__GCF_001294205.1:WP_053939471.1 Length = 291 Score = 120 bits (301), Expect = 4e-32 Identities = 88/253 (34%), Positives = 135/253 (53%), Gaps = 19/253 (7%) Query: 56 RLQGKRCLITAAGAGIGRESALACARAGAHVIATDI-----DAA-ALQALAAESDAITTQ 109 RLQG++ L+T A +GIGR +A+A AR GA V+ + DA ++ + AE Sbjct: 45 RLQGRKALVTGADSGIGRAAAIAYAREGADVVLNYLPEEEPDAQEVVKLIEAEGRKAICI 104 Query: 110 LLDVTDAAAITALVA----AHGPFDVLFNCAG-YVHQGSILDCDEPAWRRSFSINVDAMY 164 D++ A LV A G D++ N AG V I D + + NV A++ Sbjct: 105 PGDISSEAFCRELVGQAHVALGGLDIVTNVAGKQVSVDDIADISSEQFDATMKTNVYALF 164 Query: 165 YTCKAVLPGMLERGRGSIINMSSVASSIKGVPNRFVYGVTKAAVIGLSKAIAADYVAQGV 224 + C+A +P +L G +IIN +S+ ++ K + Y TKAA++ +KA+A +++G+ Sbjct: 165 WICQAAVP-LLPPG-ATIINTTSIQAT-KPSESLLDYATTKAAILAFTKALAKQVISKGI 221 Query: 225 RCNAICPGTIKTPSLGQRVQALGGDEQAVWKSFTDRQPMGRLGDPREIAQLVVYLASDES 284 R NA+ PG I T +Q GG Q + F ++ GR G P E+A L V LAS+ES Sbjct: 222 RVNAVAPGPIWTV-----LQPSGGQSQEKVEHFGEQSVFGRPGQPVELAPLYVLLASEES 276 Query: 285 SFTTGQTHIIDGG 297 S+ TG+ + I GG Sbjct: 277 SYVTGEIYGITGG 289 Lambda K H 0.320 0.133 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 181 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 291 Length adjustment: 26 Effective length of query: 274 Effective length of database: 265 Effective search space: 72610 Effective search space used: 72610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory