Align ABC transporter for D-glucosamine, permease component 2 (characterized)
to candidate WP_053937456.1 WG78_RS08860 amino acid ABC transporter permease
Query= reanno::pseudo3_N2E3:AO353_21720 (220 letters) >NCBI__GCF_001294205.1:WP_053937456.1 Length = 221 Score = 129 bits (323), Expect = 6e-35 Identities = 66/189 (34%), Positives = 118/189 (62%) Query: 29 SVLAIMLGTLIGIVAGLVLTYGTLWMRAPFRFYVDLIRGTPVFVLVLACFYMAPALGWQI 88 +V A++ G L+G + ++ G ++ P YV +RGTP+ V + +Y PA+G Q Sbjct: 25 AVGAMVGGLLVGALLAVLRLSGIKALQWPAALYVSAMRGTPLLVQIFIIYYGLPAIGIQF 84 Query: 89 DAFQAGVLGLTLFCGSHVAEIVRGALQALPRGQMEASKAIGLTFYQALAYVLLPQALRQI 148 + AG+L L+L G++V+E +RGA+ + RGQ EA+ + G+ +Q L Y++ PQALR Sbjct: 85 EPITAGILALSLNTGAYVSETMRGAINGVDRGQWEAAFSQGMGRWQTLHYIVWPQALRLA 144 Query: 149 LPTWVNSSTEIVKASTLLSVIGVAELLLSTQQIIARTFMTLEFYLFAGFLFFIINYAIEL 208 +P+ NS ++K ++L+SVI V EL+L+T+++I+ TF Y+ A +++ ++ E Sbjct: 145 VPSLSNSLISLIKDTSLVSVIAVTELMLATKEVISTTFQPFPLYVAAAAIYWCLSLIFEQ 204 Query: 209 LGRHIEKRV 217 + R +E+R+ Sbjct: 205 VQRLLERRL 213 Lambda K H 0.330 0.142 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 105 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 220 Length of database: 221 Length adjustment: 22 Effective length of query: 198 Effective length of database: 199 Effective search space: 39402 Effective search space used: 39402 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory