Align D-galactarolactone cycloisomerase (EC 5.5.1.27) (characterized)
to candidate WP_053939463.1 WG78_RS19245 galactonate dehydratase
Query= BRENDA::A9CEQ8 (378 letters) >NCBI__GCF_001294205.1:WP_053939463.1 Length = 382 Score = 154 bits (389), Expect = 4e-42 Identities = 103/290 (35%), Positives = 151/290 (52%), Gaps = 19/290 (6%) Query: 32 VLVEIECDDGTVGWGECL--GPARPNAAVVQAYSGWLIGQDPRQTEKIWAVLYNALRDQG 89 + ++IE D+G VGWGE + G A+ A V S +LIGQDP + +W VLY A +G Sbjct: 16 MFLKIETDEGIVGWGEPVLEGRAKTVEAAVHEMSEYLIGQDPARINDLWQVLYRAGFYRG 75 Query: 90 QRGLSLTALSGIDIALWDIKGKHYGASISMLLGGRWRESVRAYA-TGSFKRDNVDRVSDN 148 G+ ++A++GID ALWDIKGK G + LLGG R+ V+ Y+ G DR +D Sbjct: 76 G-GILMSAIAGIDQALWDIKGKALGVPVYQLLGGLVRDRVKTYSWVGG------DRPADI 128 Query: 149 ASEMAERRAEGFHACK---------IKIGFGVEEDLRVIAAVREAIGPDMRLMIDANHGY 199 ++ R GF K I ++ +R +A +REA G + +D + Sbjct: 129 IRDIQARVDVGFDTFKMNGCEELAVIDNSRAIDAAVRKVAEIREAFGNKIEFGLDFHGRV 188 Query: 200 TVTEAITLGDRAAGFGIDWFEEPVVPEQLDAYARVRAGQPIPVAGGETWHGRYGMWQALS 259 T A L + + EEPV+ EQ + Y ++ A IP+A GE + R+ L+ Sbjct: 189 TAPMARVLIKELEPYRPLFIEEPVLAEQAEYYPKLAAQTHIPLAAGERMYSRFEFKNVLA 248 Query: 260 AGAVDILQPDLCGCGGFSEIQKIATLATLHGVRIVPHVWGTGVQIAAALQ 309 AG + ILQPDL GG +E KIA++A + V + PH + +AA LQ Sbjct: 249 AGGLSILQPDLSHAGGITECMKIASMAEAYDVALAPHCPLGPIALAACLQ 298 Lambda K H 0.321 0.138 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 384 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 382 Length adjustment: 30 Effective length of query: 348 Effective length of database: 352 Effective search space: 122496 Effective search space used: 122496 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory