Align gluconolactonase (EC 3.1.1.17) (characterized)
to candidate WP_053939460.1 WG78_RS19225 SMP-30/gluconolactonase/LRE family protein
Query= BRENDA::Q64374 (299 letters) >NCBI__GCF_001294205.1:WP_053939460.1 Length = 301 Score = 106 bits (264), Expect = 7e-28 Identities = 78/266 (29%), Positives = 124/266 (46%), Gaps = 26/266 (9%) Query: 35 PSKIICRWDTVSNQVQRVAVDAPVSSVALRQLGGYVATIGTKFCALNWENQSVFVLAMVD 94 P ++ C T + V VA DA ++ N + ++ L V+ Sbjct: 59 PQRVCCFAFTQDDDVLLVAFDAGLA-------------------LFNTASGAIKRLTPVE 99 Query: 95 EDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGSLYSLFPDHSVKKY-FDQVDIS 153 + R NDG+VD AG GTM E +A A +G Y + +++ + IS Sbjct: 100 PETPGTRCNDGRVDRAGNLVFGTMHERSAEA-----KGHFYRFDTESRLQQLALPAIAIS 154 Query: 154 NGLDWSLDHKIFYYIDSLSYTVDAFDYDLQTGQISNRRIVYKMEKDEQIPDGMCIDAEGK 213 N L +S D Y+ DSL + + YD TG I+ + + + PDG +DA G Sbjct: 155 NSLAFSPDGGTLYWCDSLQHKIMQCAYDSVTGAIAEISVFHDLGDTVIEPDGSTVDAAGY 214 Query: 214 LWVACYNGGRVIRLDPETGKRLQTVKLPVDKTTSCCFGGKDYSEMYVTCARDGLNAEGLL 273 LW A + G V R P+ G + + LPV + T FGG + + +++T AR GL+ L Sbjct: 215 LWNAEWAGHCVTRYAPD-GSIDRKIHLPVAQPTCVTFGGPEQNTLFITSARAGLDDAALA 273 Query: 274 RQPDAGNIFKITGLGVKGIAPYSYAG 299 +QP+AG++F + GV+G+ + G Sbjct: 274 QQPEAGSVFALEIPGVRGLPENIWLG 299 Lambda K H 0.319 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 260 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 301 Length adjustment: 27 Effective length of query: 272 Effective length of database: 274 Effective search space: 74528 Effective search space used: 74528 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory