Align glutarate-semialdehyde dehydrogenase (EC 1.2.1.20) (characterized)
to candidate WP_053937126.1 WG78_RS07195 CoA-acylating methylmalonate-semialdehyde dehydrogenase
Query= BRENDA::Q88RC0 (480 letters) >NCBI__GCF_001294205.1:WP_053937126.1 Length = 507 Score = 205 bits (522), Expect = 3e-57 Identities = 149/462 (32%), Positives = 228/462 (49%), Gaps = 14/462 (3%) Query: 11 QQAYINGEWLD--ADNGQTIK---VTNPATGEVIGTVPKMGTAETRRAIEAADKALPAWR 65 QQ + G W++ A GQ+ + V PA G+V G V E A+ +A A PAW Sbjct: 8 QQLKLAGHWINGLAVAGQSDRFGEVFCPAEGKVSGRVSLANVDEVASAVASAKAAFPAWA 67 Query: 66 ALTAKERSAKLRRWFELMIENQDDLARLMTTEQGKPLAEAKGEIAYAASFIEWFAEEAKR 125 A R+ + R+ +++ +N D LA L+ TE GK LA+A GEI +E+ Sbjct: 68 ATPPLRRARVMFRFRQIVEDNIDTLAHLIATEHGKVLADAVGEIQRGLEVVEFATGIPSL 127 Query: 126 IYGDTIPGHQPDKRLIVIKQPIGVTAAITPWNFPAAMITRKAGPALAAGCTMVLKPASQT 185 + + ++QP+GV A +TP+NFPA + ALA+G VLKP+ + Sbjct: 128 LKSEMTENVGTGVDSYSLRQPLGVVAGVTPFNFPAMVPLWMFPVALASGNCFVLKPSERV 187 Query: 186 PYSALALVELAHRAGIPAGVLSVVTGSAGEVGGELTGNSLVRKLSFTGSTEIGRQLMEEC 245 P ++L L + +AG+P GV +VV G V L + V+ LSF GST I R + + Sbjct: 188 PGASLLLAQWLKQAGLPDGVFNVVQGDKVAVDA-LLDHPDVQALSFVGSTPIARYIYQRG 246 Query: 246 AKDIKKVSLELGGNAPFIVFDDADLDKAVEGAIISKYRNNGQTCVCANRIY-VQDGVYDA 304 + K+V G +V DADLD+A + + + Y G+ C+ + + V DA Sbjct: 247 TANGKRVQALGGAKNHMVVMPDADLDQAADALMGAAYGAAGERCMAISVVVPVGAATADA 306 Query: 305 FAEKLAAAVAKLKIGNGLEEGTTTGPLIDGKAVAKVQEHIEDAVSKGAKVLSGGKLI--- 361 EKL A +AKL++ L+ GPLI KV+ +I+ V++GA ++ G+ + Sbjct: 307 LREKLVARLAKLRVSYSLDSQAEMGPLISAPHRDKVRGYIDSGVAEGADLVVDGRGLHVA 366 Query: 362 --EGNFFEPTILVD-VPKTAAVAKEETFGPLAPLFRFKDEAEVIAMSNDTEFGLASYFYA 418 E FF L D V + + +EE FGP+ + R D A + + N EFG + + Sbjct: 367 GHEAGFFLGGSLFDHVTPSMKIYREEIFGPVLAITRAPDYATALNLVNAHEFGNGAAIFT 426 Query: 419 RDMSRVFRVAEALEYGMVGINTGL-ISNEVAPFGGIKASGLG 459 RD + A ++ GMVG+N + + FGG KAS G Sbjct: 427 RDGATARHFASHVQIGMVGVNVPIPVPMAFHSFGGWKASLFG 468 Lambda K H 0.317 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 525 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 480 Length of database: 507 Length adjustment: 34 Effective length of query: 446 Effective length of database: 473 Effective search space: 210958 Effective search space used: 210958 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory