Align Galactitol 2-dehydrogenase; GDH; Sorbitol dehydrogenase; SorbD; EC 1.1.1.16; EC 1.1.1.- (characterized)
to candidate WP_053936590.1 WG78_RS04575 3-oxoacyl-ACP reductase FabG
Query= SwissProt::A9CES4 (256 letters) >NCBI__GCF_001294205.1:WP_053936590.1 Length = 246 Score = 149 bits (377), Expect = 4e-41 Identities = 96/255 (37%), Positives = 140/255 (54%), Gaps = 15/255 (5%) Query: 1 MRLNNKVALITGAARGIGLGFAQAFAAEGAKVIIADIDIA---RATTSAAAIGPAAKAVK 57 M+L NKVA+ITGAA GIG A+ F EGA+V++ D++ A + A G A + Sbjct: 1 MKLKNKVAIITGAASGIGHATARKFVTEGARVVVCDVNRAGVDAVVSELIAQGGQALGFE 60 Query: 58 LDVTDLAQIDAVVKAVDEEFGGIDILVNNAAIFDMAPINGITEESYERVFDINLKGPMFM 117 +DVT+ AQI A+V ++FG IDILVNNA I A ++ +TE+ ++RV DINLKG Sbjct: 61 VDVTNKAQIAAMVAGTQQQFGRIDILVNNAGIVADAQLSKMTEDQFDRVIDINLKGVYNC 120 Query: 118 MKAVSNVMIARARGGKIINMASQAGRRGEALVTLYCASKAAIISATQSAALALVKHGINV 177 +AV ++MI + + G I+N +S G G T Y A+K +I ++ A L K GI Sbjct: 121 TRAVVDIMIEQ-QSGVILNASSVVGLYGNFGQTNYAAAKFGVIGMVKTWARELGKKGIRA 179 Query: 178 NAIAPGVVDGEHWEVVDAHFAKWEGLKPGEKKAAVAKSVPIGRFATPDDIKGLAVFLASA 237 NA+ PG V + + P + + + VP+ R A P++I + FLAS Sbjct: 180 NAVCPGFVATPILKDM-----------PDKVIQGMEERVPLRRMAQPEEIANVYAFLASD 228 Query: 238 DSDYILAQTYNVDGG 252 ++ YI V GG Sbjct: 229 EASYISGAAIEVTGG 243 Lambda K H 0.319 0.133 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 246 Length adjustment: 24 Effective length of query: 232 Effective length of database: 222 Effective search space: 51504 Effective search space used: 51504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory