Align aldehyde dehydrogenase (NAD+) (EC 1.2.1.3) (characterized)
to candidate WP_053938969.1 WG78_RS16670 NAD-dependent succinate-semialdehyde dehydrogenase
Query= BRENDA::Q8BH00 (487 letters) >NCBI__GCF_001294205.1:WP_053938969.1 Length = 466 Score = 294 bits (753), Expect = 4e-84 Identities = 156/467 (33%), Positives = 258/467 (55%), Gaps = 10/467 (2%) Query: 7 LLMLENFIGGKFLPCNSY--IDSYDPSTGEVYCKVPNSGKEEIEAAVEAAREAFPAWSSR 64 LL + F+ G ++ ++ + +P+TGE+ +P GK E A+EAA+ A+PAW S+ Sbjct: 8 LLRQQCFVNGAWIDADNQETVPVNNPATGEIIAHIPKLGKAETRRAIEAAQAAWPAWRSK 67 Query: 65 SPQERSLVLNRLADVLEQSLEELAQAESKDQGKTLTLARTMDIPRSVLNFRFFASSNLHH 124 + +ERS +L + D++ ++++LA + +QGK L AR +I + +FA Sbjct: 68 TAKERSQILRKWNDLMLANVDDLALILTSEQGKPLAEARG-EITYAASYIEWFAEEARRI 126 Query: 125 VSECTQMSHLGCMHYTVRTPVGIAGLISPWNLPLYLLTWKIAPAIAAGNTVIAKPSEMTS 184 + ++ P+G+ I+PWN P ++T K+ PA+AAG ++ KP+ T Sbjct: 127 EGDIIAPPSNDRRILVLKQPIGVTAAITPWNFPAAMITRKVGPALAAGCPMVLKPATQTP 186 Query: 185 VTAWMFCKLLDKAGVPPGVINIVFGTGPRVGEALVSHPEVPLISFTGSQPTAERITQLSA 244 ++A L ++AGVP G+ N++ G+ +G L + P V I+FTGS ++ + SA Sbjct: 187 LSALALAVLAERAGVPAGIFNVLTGSSTEIGGELTASPIVRKITFTGSTEVGAKLIEQSA 246 Query: 245 PHCKKLSLELGGKNPAIIFEDANLEECIPATVRSSFANQGEICLCTSRIFVQRSIYSEFL 304 P KK+S+ELGG P I+F+DA+L+ + + S + N G+ C+C +R+ VQ +Y F Sbjct: 247 PTIKKMSMELGGNAPFIVFDDADLDAAVQGAIGSKYRNSGQTCVCANRLLVQAGVYDAFA 306 Query: 305 KRFVEATRKWKVGVPSDPSANMGALISKAHLEKVRSYVLKAQTEGARILCGEGVDQLSLP 364 ++ +A KVG D G LI + K+ ++ A +GA++L G L Sbjct: 307 QKLADAVNALKVGNGVDDGVTQGPLIDDKAIAKIEEHIADATGKGAQVLTGGKRHAL--- 363 Query: 365 LRNQAGYFMLPTVITDIKDESRCMTEEIFGPVTCVVPFDSEEEVITRANSVRYGLAATVW 424 G F PT++T + + EE FGP+ + F++EEE I AN +GLA+ + Sbjct: 364 ----GGTFFEPTILTGVTPAMKVAREETFGPLAPLFKFETEEEAIAMANDTEFGLASYFY 419 Query: 425 SKDVGRIHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGIGREGAK 471 ++D+ RI RVA+ L+ G+V N LI PFGG+K SG+GREG++ Sbjct: 420 TRDLARIFRVAEGLEYGMVGINAGLISSEVAPFGGVKQSGLGREGSR 466 Lambda K H 0.319 0.134 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 503 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 487 Length of database: 466 Length adjustment: 33 Effective length of query: 454 Effective length of database: 433 Effective search space: 196582 Effective search space used: 196582 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory