Align Xylonolactonase (EC 3.1.1.68) (characterized)
to candidate WP_053939460.1 WG78_RS19225 SMP-30/gluconolactonase/LRE family protein
Query= reanno::Korea:Ga0059261_1893 (295 letters) >NCBI__GCF_001294205.1:WP_053939460.1 Length = 301 Score = 159 bits (403), Expect = 6e-44 Identities = 99/281 (35%), Positives = 142/281 (50%), Gaps = 5/281 (1%) Query: 18 LLEGPVWVQRDAALWFVDIKSHRIHRFDPASGERRSWDAPAQVG-FCLPAANGKFVAGLQ 76 L EG + + LW+ +I + + + D +G+ R W P +V F + + Sbjct: 20 LAEGIIQHPQSGLLWWTNIHAKELWQLDLRTGQHRYWSTPQRVCCFAFTQDDDVLLVAFD 79 Query: 77 TGLAIFDPADRSFTPLTDPEPALPGNRLNDGTVDPAGRLWFGTMDDGESEATGRIYRLGG 136 GLA+F+ A + LT EP PG R NDG VD AG L FGTM + +EA G YR Sbjct: 80 AGLALFNTASGAIKRLTPVEPETPGTRCNDGRVDRAGNLVFGTMHERSAEAKGHFYRFDT 139 Query: 137 DGRCVA-ETAAVSISNGPAVSPDGRTLYHVDTLGGVIHSAAIGD-DGILGDSRVFATIPN 194 + R A++ISN A SPDG TLY D+L I A G + + VF + + Sbjct: 140 ESRLQQLALPAIAISNSLAFSPDGGTLYWCDSLQHKIMQCAYDSVTGAIAEISVFHDLGD 199 Query: 195 SEGFPDGPAVDAEGCVWIGLYNGAAVRRYSPAGELLDVVAFPVGAITKVAFGGPDLRTVY 254 + PDG VDA G +W + G V RY+P G + + PV T V FGGP+ T++ Sbjct: 200 TVIEPDGSTVDAAGYLWNAEWAGHCVTRYAPDGSIDRKIHLPVAQPTCVTFGGPEQNTLF 259 Query: 255 ATTASKHLDADGRAEEPHAGDLFAFRVSVPGMPGTEVSVGL 295 T+A LD A++P AG +FA + +PG+ G ++ L Sbjct: 260 ITSARAGLDDAALAQQPEAGSVFA--LEIPGVRGLPENIWL 298 Lambda K H 0.319 0.139 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 335 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 301 Length adjustment: 26 Effective length of query: 269 Effective length of database: 275 Effective search space: 73975 Effective search space used: 73975 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory