Protein WP_082366659.1 in Acidovorax caeni R-24608
Annotation: NCBI__GCF_001298675.1:WP_082366659.1
Length: 393 amino acids
Source: GCF_001298675.1 in NCBI
Candidate for 23 steps in catabolism of small carbon sources
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|
| L-histidine catabolism | PA5503 | hi | Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) | 51% | 99% | 305.8 | Methionine import ATP-binding protein MetN; EC 7.4.2.11 | 47% | 292.0 |
| L-arginine catabolism | artP | med | BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) | 44% | 97% | 188 | Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN | 51% | 305.8 |
| L-histidine catabolism | bgtA | med | BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) | 44% | 97% | 188 | Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN | 51% | 305.8 |
| L-lysine catabolism | hisP | med | BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) | 44% | 97% | 188 | Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN | 51% | 305.8 |
| L-histidine catabolism | hisP | med | histidine transport ATP-binding protein hisP (characterized) | 43% | 95% | 178.7 | Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN | 51% | 305.8 |
| L-citrulline catabolism | PS417_17605 | med | ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) | 42% | 87% | 173.7 | Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN | 51% | 305.8 |
| L-histidine catabolism | hutV | med | ABC transporter for L-Histidine, ATPase component (characterized) | 42% | 80% | 164.1 | Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN | 51% | 305.8 |
| L-citrulline catabolism | AO353_03040 | lo | ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized) | 39% | 96% | 173.7 | Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN | 51% | 305.8 |
| L-asparagine catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 39% | 94% | 170.6 | Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN | 51% | 305.8 |
| L-aspartate catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 39% | 94% | 170.6 | Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN | 51% | 305.8 |
| L-glutamate catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 39% | 94% | 170.6 | Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN | 51% | 305.8 |
| L-histidine catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 39% | 94% | 170.6 | Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN | 51% | 305.8 |
| L-leucine catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 39% | 94% | 170.6 | Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN | 51% | 305.8 |
| L-proline catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 39% | 94% | 170.6 | Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN | 51% | 305.8 |
| L-proline catabolism | proV | lo | glycine betaine/l-proline transport atp-binding protein prov (characterized) | 42% | 55% | 169.9 | Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN | 51% | 305.8 |
| L-asparagine catabolism | peb1C | lo | PEB1C, component of Uptake system for glutamate and aspartate (characterized) | 38% | 98% | 164.5 | Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN | 51% | 305.8 |
| L-aspartate catabolism | peb1C | lo | PEB1C, component of Uptake system for glutamate and aspartate (characterized) | 38% | 98% | 164.5 | Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN | 51% | 305.8 |
| L-glutamate catabolism | gltL | lo | PEB1C, component of Uptake system for glutamate and aspartate (characterized) | 38% | 98% | 164.5 | Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN | 51% | 305.8 |
| L-asparagine catabolism | aatP | lo | ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, ATPase component (characterized) | 38% | 100% | 163.3 | Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN | 51% | 305.8 |
| L-aspartate catabolism | aatP | lo | ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, ATPase component (characterized) | 38% | 100% | 163.3 | Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN | 51% | 305.8 |
| D-mannose catabolism | TM1750 | lo | TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) | 36% | 79% | 161.8 | Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN | 51% | 305.8 |
| L-proline catabolism | hutV | lo | HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) | 40% | 81% | 154.8 | Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN | 51% | 305.8 |
| L-tryptophan catabolism | ecfA1 | lo | Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale) | 34% | 90% | 142.9 | Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN | 51% | 305.8 |
Sequence Analysis Tools
View WP_082366659.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MASNTLTARRMFAGWGGLPGRVQAADTRRGTPTHAAPRGAGAVAFRDVAKTYRSSAGTVQ
ALDAISLEIAPGSIFGIIGRSGAGKSSLLRTINRLEQPTSGQVLVDGVDIGTLSEAGLVQ
LRRRIGMIFQHFNLLSAKTVAENVALPLKVAGVPAAQIAARVQELLLLVGLQDKADTYPS
RLSGGQKQRVGVARALATGPEILLCDEATSALDPETTHSILQLLRDINRTLGITVVLITH
EMSVIREIADQVLVLEQGRIAELGAVWQVFGNPQHAATRALLAPLQHGLPDDLQQRLQAL
PPAGAYTQILQLGYRGEDGLEPDLPRIAQALGARVRLLHGGVDRIQGHAQGQLLVALEGA
AARADWTSFTQGREAIAHEIKVLGYVAESVHPH
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory