Align ABC transporter for L-Asparagine and possibly other L-amino acids, permease component 2 (characterized)
to candidate WP_054257453.1 BN2503_RS14980 amino acid ABC transporter permease
Query= reanno::pseudo13_GW456_L13:PfGW456L13_4772 (223 letters) >NCBI__GCF_001298675.1:WP_054257453.1 Length = 223 Score = 206 bits (523), Expect = 4e-58 Identities = 107/206 (51%), Positives = 142/206 (68%), Gaps = 6/206 (2%) Query: 18 GMIMTLKLMAMGVIGGIILGTILALMRLSHNKVLSNIAGAYVNYFRSIPLLLVITWFYLA 77 G+ ++ L + +GG+ GT+LALMRLS K L A YVN RSIPL++VI WF+L Sbjct: 22 GLTFSVLLTIVATLGGVFFGTLLALMRLSGKKWLVVPATIYVNGMRSIPLVMVILWFFLL 81 Query: 78 VPFVLRWITGEDTPIGAFASCIVAFMMFEAAYFCEIVRAGVQSIPKGQMGAAQALGMSYG 137 VP ++ PIGA +S ++ F+ FEAAYF EI+RAG+QSIP+GQ+ A QALGM+YG Sbjct: 82 VPLII------GRPIGAESSAVITFVAFEAAYFSEIMRAGIQSIPRGQVFAGQALGMTYG 135 Query: 138 QMMRLIILPQAFRKMTPLLLQQSIILFQDTSLVYAVGLVDFLNASRASGDIIGRSNEFLI 197 Q M+L+ILPQAFR M P+LL Q+IILFQDTSLVYA+G D L +G GR E + Sbjct: 136 QNMKLVILPQAFRNMLPVLLTQTIILFQDTSLVYAIGAYDMLKGFEVAGKNFGRPIEAYL 195 Query: 198 FAGLVYFIISFAASQLVKRLQKRFAV 223 A ++YF++ +A S VKRL K+ A+ Sbjct: 196 AAAVLYFVMCYALSWSVKRLHKKIAI 221 Lambda K H 0.332 0.144 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 223 Length of database: 223 Length adjustment: 22 Effective length of query: 201 Effective length of database: 201 Effective search space: 40401 Effective search space used: 40401 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory