Align PEP1B, component of Uptake system for glutamate and aspartate (characterized)
to candidate WP_054254746.1 BN2503_RS00885 amino acid ABC transporter permease
Query= TCDB::A1VZQ3 (250 letters) >NCBI__GCF_001298675.1:WP_054254746.1 Length = 217 Score = 122 bits (305), Expect = 8e-33 Identities = 65/202 (32%), Positives = 115/202 (56%), Gaps = 4/202 (1%) Query: 47 GFIYTLEVSILALLIATIFGTIGGVMATSRFKIIRAYTRIYVELFQNVPLVIQIFFLFYA 106 G + TL++ ++ L++A G + + SR K++ A Y+ L + PL++Q+ F+++A Sbjct: 14 GALVTLKLFVITLVLAVPLGLVLALARLSRLKLLSAGVNGYIWLMRGTPLMLQMLFIYFA 73 Query: 107 LP---VLGIRLDIFTIGVLGVGAYHGAYVSEVVRSGILAVPRGQFEASASQGFTYIQQMR 163 LP V+G+RL F V + AY +E+ R+GI +V RGQ+EA+ G Y Q MR Sbjct: 74 LPFVPVIGVRLPDFPAAVAAFALNYAAYFAEIFRAGIQSVDRGQYEAAKVLGMNYGQTMR 133 Query: 164 YIIVPQTIRIILPPMTNQMVNLIKNTSVLLIVGGAELMHSADSYAADYGNYAPAYIFAAV 223 +++PQ +R ILPPM+N+ + L+K+TS++ ++ +L+ +A P +I AA Sbjct: 134 RVVLPQMVRNILPPMSNETITLVKDTSLIYVLALNDLLRAARGIVQRDFTTTP-FIVAAA 192 Query: 224 LYFIICYPLAYFAKAYENKLKK 245 Y ++ L + + E + K Sbjct: 193 FYLVMTLVLTWAFQRLEQRYAK 214 Lambda K H 0.328 0.143 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 160 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 217 Length adjustment: 23 Effective length of query: 227 Effective length of database: 194 Effective search space: 44038 Effective search space used: 44038 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory