Align The pmf-dependent citrate uptake system, Cit1 (characterized)
to candidate WP_054255660.1 BN2503_RS05555 DASS family sodium-coupled anion symporter
Query= TCDB::Q6D017 (484 letters) >NCBI__GCF_001298675.1:WP_054255660.1 Length = 485 Score = 432 bits (1110), Expect = e-125 Identities = 220/461 (47%), Positives = 300/461 (65%), Gaps = 12/461 (2%) Query: 30 PAGLNPAAWHSAVIFVATIVCIVANVLPIGAIGIISITLFALTYAAGDKTASGAIQTALS 89 PAG+ P AWH +FV TI I+ LPIGA+ II+I L A+T DK A+GAI ALS Sbjct: 25 PAGVTPDAWHLLGLFVGTIAAIIGKALPIGALSIIAIALVAVTGVTNDK-AAGAINDALS 83 Query: 90 DLNSSLIWLIVVAFMIARGFIKTGLGRRIALQMIRLLGKRTLGLAYGLAFADLVLSPAMP 149 ++SLIWLI V+ MI+RG IKTGLG RI I + GK+T+G+AY LA ++L+L+P P Sbjct: 84 SFSNSLIWLIGVSIMISRGIIKTGLGARIGYLFIAVWGKKTIGIAYSLALSELILAPVTP 143 Query: 150 SNTARCGGIIYPIADSLSRSFDSKPEDASRSKIGTFLITCIGNVNDVTAAMFMTAYTGNL 209 SNTAR GGII+PI +++ S+ S PE ++ ++G +L + N +T+AMF+TA N Sbjct: 144 SNTARGGGIIHPIMRAIAGSYGSDPEKGTQGRMGRYLALTNYHANPITSAMFITATAPNP 203 Query: 210 LAVKLAAN---AGVTITWGSWFLAALVPCLISLAIVPLLVYWLTKPEIRHTPDAPKLAVA 266 L VKL A+ A ++++WG+W LA L+P L++LA++PL++Y L PEI+ TP+A + A Sbjct: 204 LVVKLIADVTGAQISLSWGTWALAMLLPGLVALAVMPLIIYMLHPPEIKSTPNAMQFARE 263 Query: 267 ELAKMGSISRGEWLMAFTVILLLVLW------IFGDRLGVDATTASFVGLSFLLLTGVLS 320 +L ++G ISRGE M +LLVLW +FG VD TT +F+GLS L+TGVL+ Sbjct: 264 KLKELGPISRGEITMFGVFAVLLVLWAGVPTFLFGPSAAVDPTTTAFIGLSLCLVTGVLT 323 Query: 321 WEDVKNEKGAWDTLIWFAALLMMANQLKKLGFTNWFGDLIGSNIGHLMQGTSWVLVLLLL 380 WEDV EK AWDT++WF AL+MMA L KLG WF I + IGH+ G SWV LL Sbjct: 324 WEDVIKEKSAWDTIVWFGALVMMATFLNKLGLITWFAKSIETGIGHM--GLSWVTASALL 381 Query: 381 NAAYFYTHYFFASGNAQIAALFAVFLGVGINLNIPAVPMAFMLAFTSSLYCSLTQYTHAR 440 Y Y HY FAS A I A+FA F G G+ L P +P A M+A S++ +LT Y Sbjct: 382 MLTYLYAHYMFASTTAHITAMFAAFYGAGLALGAPPLPFALMMAAASNIMMTLTHYATGT 441 Query: 441 GPILFGAGYVPTAVWWRTGFVVSLVNQAIFMGAGLLWWKAI 481 P++FG+GY WW+TGF++SL AI++ G +WWK + Sbjct: 442 SPVIFGSGYTTLGEWWKTGFIMSLALLAIWLVVGGVWWKVL 482 Lambda K H 0.327 0.139 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 848 Number of extensions: 49 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 484 Length of database: 485 Length adjustment: 34 Effective length of query: 450 Effective length of database: 451 Effective search space: 202950 Effective search space used: 202950 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory